BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_P08 (506 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 26 0.17 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 26 0.22 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 25 0.39 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 23 1.2 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 1.2 AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax prot... 23 1.2 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 22 3.6 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 21 6.3 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 6.3 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 26.2 bits (55), Expect = 0.17 Identities = 25/85 (29%), Positives = 37/85 (43%), Gaps = 2/85 (2%) Frame = -1 Query: 251 LKPNTNTTSGVTLYI-LASFSRISVLLTVGFPGCKTSQTICLRANNLLVMNLRVRIVAVP 75 L+ N T G T ++ SF+ I L+ QTI L+ + N ++ Sbjct: 178 LECNNTTAEGFTYFLGNMSFAHIFALVEYDIFKALVLQTINLQITFIWTYNDLFVMLIST 237 Query: 74 SLILNYFQIIRRLHARVSAK-TREK 3 +L + QI RR+ A S K T EK Sbjct: 238 ALAYRFGQITRRIAAVASEKVTSEK 262 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 25.8 bits (54), Expect = 0.22 Identities = 22/84 (26%), Positives = 36/84 (42%), Gaps = 1/84 (1%) Frame = -1 Query: 251 LKPNTNTTSGVTLYI-LASFSRISVLLTVGFPGCKTSQTICLRANNLLVMNLRVRIVAVP 75 L+ N T G T ++ SF+ I L+ QTI L+ + N ++ Sbjct: 178 LECNNTTAEGFTYFLGNMSFAHIFALVEYDIFKALVLQTINLQITFIWTYNDLFVMLIST 237 Query: 74 SLILNYFQIIRRLHARVSAKTREK 3 +L + QI RR+ A S K + + Sbjct: 238 ALAYRFGQITRRIAAVASEKIKNE 261 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 25.0 bits (52), Expect = 0.39 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 223 PDVVFVFGFKTNFGGGKSTG 282 PD VF+ F+T+F GK +G Sbjct: 107 PDDVFIRKFETSFESGKPSG 126 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 23.4 bits (48), Expect = 1.2 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 7/48 (14%) Frame = +1 Query: 295 YDTLDLAKKFEPKHRLAR-------HGLYEKKRPTRKQRKERKNRMKK 417 Y TL+L K+F H L R H L +R + + R+ ++KK Sbjct: 233 YQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 280 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 23.4 bits (48), Expect = 1.2 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -3 Query: 489 IHLYLAFTSLLGGRTYFRFLGTADLLHSVLTFFTLF 382 IHL++ L+G + + L HSV F T+F Sbjct: 778 IHLFVKCVFLMGYQIFDWVQKEQSLAHSVGVFLTIF 813 >AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax protein. Length = 96 Score = 23.4 bits (48), Expect = 1.2 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 7/48 (14%) Frame = +1 Query: 295 YDTLDLAKKFEPKHRLAR-------HGLYEKKRPTRKQRKERKNRMKK 417 Y TL+L K+F H L R H L +R + + R+ ++KK Sbjct: 15 YQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 62 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.8 bits (44), Expect = 3.6 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +3 Query: 75 RNSDYSHSQIHDQQIVGAQADGLRCFTS 158 R DY + + DQ +V +G+R +S Sbjct: 178 RCKDYKNEDLEDQPVVYNDVNGVRINSS 205 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 21.0 bits (42), Expect = 6.3 Identities = 7/22 (31%), Positives = 15/22 (68%) Frame = +3 Query: 219 YSRCSVRIRFQDKLRRWQINWI 284 Y+ +R++FQ KL +++W+ Sbjct: 341 YASNCLRVQFQKKLLLVELSWM 362 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.0 bits (42), Expect = 6.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +1 Query: 106 MTNRLLARKQMVCDVLHPGKPTV 174 +TN+ Q++ + LH KPTV Sbjct: 134 LTNKSNGNGQIMLNSLHKYKPTV 156 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,197 Number of Sequences: 336 Number of extensions: 2773 Number of successful extensions: 9 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12049355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -