BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_P08 (506 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 23 1.4 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 23 1.4 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 4.2 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 9.7 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 9.7 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 9.7 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 23.4 bits (48), Expect = 1.4 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -1 Query: 131 LRANNLLVMNLRVRIVAVPSLILNYFQIIRRLHARVS 21 +R N L R VP + Y Q+I LH R+S Sbjct: 298 MRFRNGLAFPQRETGATVPLHMQKYVQMIHDLHTRIS 334 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 23.4 bits (48), Expect = 1.4 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -1 Query: 131 LRANNLLVMNLRVRIVAVPSLILNYFQIIRRLHARVS 21 +R N L R VP + Y Q+I LH R+S Sbjct: 298 MRFRNGLAFPQRETGATVPLHMQKYVQMIHDLHTRIS 334 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 4.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 250 KTNFGGGKSTGFALIYDTLDLA 315 KTN G S+G L+ + D+A Sbjct: 724 KTNLSGDSSSGTTLLLELDDIA 745 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 20.6 bits (41), Expect = 9.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 148 VLHPGKPTVSKTEIREK 198 +LHP + T K REK Sbjct: 15 LLHPSRCTQGKVNYREK 31 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 20.6 bits (41), Expect = 9.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 148 VLHPGKPTVSKTEIREK 198 +LHP + T K REK Sbjct: 15 LLHPSRCTQGKVNYREK 31 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 20.6 bits (41), Expect = 9.7 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +3 Query: 60 IQNE*RNSDYSHS 98 I++E NSDYSH+ Sbjct: 224 IKHESDNSDYSHT 236 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,256 Number of Sequences: 438 Number of extensions: 3160 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13986774 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -