BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_O20 (457 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1685.10 |rps27||40S ribosomal protein S27|Schizosaccharomyce... 137 9e-34 SPBC3H7.10 |||elongator homolog|Schizosaccharomyces pombe|chr 2|... 25 4.2 >SPBC1685.10 |rps27||40S ribosomal protein S27|Schizosaccharomyces pombe|chr 2|||Manual Length = 83 Score = 137 bits (331), Expect = 9e-34 Identities = 59/82 (71%), Positives = 69/82 (84%) Frame = +3 Query: 33 MPLAIDLLHPSPASEXRKHKLKRLVPHPNSYFMDVKCPGCYKXTTVFSHAQRVVVCAGCS 212 M LA+DLL+PS SE RKHKLK+LV P S+FMDVKCPGC+ TTVFSHAQ VV+C C+ Sbjct: 1 MVLAVDLLNPSHESEMRKHKLKQLVQGPRSFFMDVKCPGCFNITTVFSHAQTVVICGSCA 60 Query: 213 TILCQPTGGRARLTEGCSFRRK 278 ++LCQPTGG+ARL EGCSFRRK Sbjct: 61 SVLCQPTGGKARLMEGCSFRRK 82 >SPBC3H7.10 |||elongator homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 249 Score = 25.4 bits (53), Expect = 4.2 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = -3 Query: 194 HHSLCVTKNCCXLVTARALNIHEIRVRMW 108 +H+L ++ C L ++ L+ H I +R W Sbjct: 37 YHALKAKESTCFLTFSKTLDEHAISMRKW 65 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,614,509 Number of Sequences: 5004 Number of extensions: 27815 Number of successful extensions: 51 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 51 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 170285640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -