BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_O13 (616 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 24 1.4 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 24 1.4 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 24 1.4 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 21 9.6 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 9.6 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 21 9.6 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 23.8 bits (49), Expect = 1.4 Identities = 9/37 (24%), Positives = 14/37 (37%) Frame = -2 Query: 561 CVGCIFALXXSKASWYAFCESXTTECLVSPVATSARY 451 C CI S W +C S C+ + + R+ Sbjct: 35 CRNCIHPTVFSVLFWLGYCNSAINPCIYALFSKDFRF 71 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 23.8 bits (49), Expect = 1.4 Identities = 9/37 (24%), Positives = 14/37 (37%) Frame = -2 Query: 561 CVGCIFALXXSKASWYAFCESXTTECLVSPVATSARY 451 C CI S W +C S C+ + + R+ Sbjct: 483 CRNCIHPTVFSVLFWLGYCNSAINPCIYALFSKDFRF 519 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -2 Query: 231 GTYDILISN*KEVPLLVAKFDAGFRHFLHRGRHV 130 G +D+ + + + V L A F HRG H+ Sbjct: 183 GAFDVTLESGERVTFLDTPGHAAFISMRHRGAHI 216 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +1 Query: 307 KEYRVKVEKELREICYDV 360 K+YRVK E+E +++ +V Sbjct: 113 KKYRVKFEEEAKKLGINV 130 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/32 (25%), Positives = 20/32 (62%) Frame = +1 Query: 265 EQKTEGSERKQQMAKEYRVKVEKELREICYDV 360 E++T +E+ +M K Y ++KE +++ ++ Sbjct: 441 EKRTIENEQLNRMYKSYPNYIDKETKDMNLEI 472 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/18 (44%), Positives = 14/18 (77%) Frame = +1 Query: 307 KEYRVKVEKELREICYDV 360 K+YRVK E+E +++ +V Sbjct: 113 KKYRVKFEEEAKKLGINV 130 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,914 Number of Sequences: 438 Number of extensions: 3074 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -