BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_O12 (383 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC047324-1|AAH47324.1| 1217|Homo sapiens structural maintenance ... 70 3e-12 AL359260-2|CAI16576.1| 1217|Homo sapiens structural maintenance ... 69 7e-12 AF020043-1|AAC14893.1| 1217|Homo sapiens chromosome-associated p... 69 7e-12 Z97054-3|CAI42646.1| 1233|Homo sapiens structural maintenance of... 36 0.034 S78271-1|AAB34405.1| 1233|Homo sapiens SB1.8/DXS423E protein. 36 0.034 D80000-1|BAA11495.2| 1233|Homo sapiens KIAA0178 protein. 36 0.034 BC112127-1|AAI12128.1| 1233|Homo sapiens SMC1 structural mainten... 36 0.034 BC080185-1|AAH80185.1| 417|Homo sapiens SMC1A protein protein. 36 0.034 BC064368-1|AAH64368.1| 847|Homo sapiens SMC1A protein protein. 36 0.034 AL161779-1|CAI42089.1| 1233|Homo sapiens structural maintenance ... 36 0.034 BC126208-1|AAI26209.1| 1161|Homo sapiens SMC1B protein protein. 34 0.18 AL021391-1|CAI18928.1| 1235|Homo sapiens structural maintenance ... 34 0.18 AL008718-2|CAI17945.1| 1235|Homo sapiens structural maintenance ... 34 0.18 AJ504806-1|CAD43404.2| 1235|Homo sapiens SMC1beta protein protein. 34 0.18 BC132750-1|AAI32751.1| 264|Homo sapiens hypothetical protein LO... 31 1.3 BC132748-1|AAI32749.1| 264|Homo sapiens hypothetical protein LO... 31 1.3 AL158063-3|CAH72181.1| 264|Homo sapiens protein ( Human DNA seq... 31 1.3 BC122527-1|AAI22528.1| 377|Homo sapiens progestin and adipoQ re... 30 2.9 BC118666-1|AAI18667.1| 377|Homo sapiens progestin and adipoQ re... 30 2.9 AY424287-1|AAR08375.1| 377|Homo sapiens progestin and adipoQ re... 30 2.9 AK123932-1|BAC85729.1| 377|Homo sapiens protein ( Homo sapiens ... 30 2.9 BC007570-1|AAH07570.1| 649|Homo sapiens FBF1 protein protein. 29 6.8 >BC047324-1|AAH47324.1| 1217|Homo sapiens structural maintenance of chromosomes 3 protein. Length = 1217 Score = 69.7 bits (163), Expect = 3e-12 Identities = 47/101 (46%), Positives = 61/101 (60%), Gaps = 6/101 (5%) Frame = +1 Query: 97 LHIKQVIIQGIQELPRANCCRAF**TT*CSQWDVMVQARVTFSTPFNLYSAMNSPISDL- 273 ++IKQVIIQG + F S+ +V+V + + NL+ A+ +SD Sbjct: 1 MYIKQVIIQGFRSYRDQTIVDPF-----SSKHNVIVGRNGSGKS--NLFYAIQFVLSDEF 53 Query: 274 -----TQRLALLHEGTGPRVISAFVEIISDNSDNRIPIEXD 381 QRLALLHEGTGPRVISAFVEII DNSDNR+PI+ + Sbjct: 54 SHLRPEQRLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKE 94 >AL359260-2|CAI16576.1| 1217|Homo sapiens structural maintenance of chromosomes 3 protein. Length = 1217 Score = 68.5 bits (160), Expect = 7e-12 Identities = 45/99 (45%), Positives = 59/99 (59%), Gaps = 4/99 (4%) Frame = +1 Query: 97 LHIKQVIIQGIQELPRANCCRAF**TT*CSQWDVMVQARVTFSTPF--NLYSAMNSPISD 270 ++IKQVIIQG + F S+ +V+V + + F + ++ S Sbjct: 1 MYIKQVIIQGFRSYRDQTIVDPF-----SSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSH 55 Query: 271 LT--QRLALLHEGTGPRVISAFVEIISDNSDNRIPIEXD 381 L QRLALLHEGTGPRVISAFVEII DNSDNR+PI+ + Sbjct: 56 LRPEQRLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKE 94 >AF020043-1|AAC14893.1| 1217|Homo sapiens chromosome-associated polypeptide protein. Length = 1217 Score = 68.5 bits (160), Expect = 7e-12 Identities = 45/99 (45%), Positives = 59/99 (59%), Gaps = 4/99 (4%) Frame = +1 Query: 97 LHIKQVIIQGIQELPRANCCRAF**TT*CSQWDVMVQARVTFSTPF--NLYSAMNSPISD 270 ++IKQVIIQG + F S+ +V+V + + F + ++ S Sbjct: 1 MYIKQVIIQGFRSYRDQTIVDPF-----SSKHNVIVGRNGSGKSNFFYAIQFVLSDEFSH 55 Query: 271 LT--QRLALLHEGTGPRVISAFVEIISDNSDNRIPIEXD 381 L QRLALLHEGTGPRVISAFVEII DNSDNR+PI+ + Sbjct: 56 LRPEQRLALLHEGTGPRVISAFVEIIFDNSDNRLPIDKE 94 >Z97054-3|CAI42646.1| 1233|Homo sapiens structural maintenance of chromosomes 1A protein. Length = 1233 Score = 36.3 bits (80), Expect = 0.034 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = +3 Query: 189 VGRNGSGKSNFFHAIQFVLSDEFSHLR 269 +G NGSGKSN AI FVL ++ S+LR Sbjct: 31 IGPNGSGKSNLMDAISFVLGEKTSNLR 57 >S78271-1|AAB34405.1| 1233|Homo sapiens SB1.8/DXS423E protein. Length = 1233 Score = 36.3 bits (80), Expect = 0.034 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = +3 Query: 189 VGRNGSGKSNFFHAIQFVLSDEFSHLR 269 +G NGSGKSN AI FVL ++ S+LR Sbjct: 31 IGPNGSGKSNLMDAISFVLGEKTSNLR 57 >D80000-1|BAA11495.2| 1233|Homo sapiens KIAA0178 protein. Length = 1233 Score = 36.3 bits (80), Expect = 0.034 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = +3 Query: 189 VGRNGSGKSNFFHAIQFVLSDEFSHLR 269 +G NGSGKSN AI FVL ++ S+LR Sbjct: 31 IGPNGSGKSNLMDAISFVLGEKTSNLR 57 >BC112127-1|AAI12128.1| 1233|Homo sapiens SMC1 structural maintenance of chromosomes 1-like 1 protein. Length = 1233 Score = 36.3 bits (80), Expect = 0.034 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = +3 Query: 189 VGRNGSGKSNFFHAIQFVLSDEFSHLR 269 +G NGSGKSN AI FVL ++ S+LR Sbjct: 31 IGPNGSGKSNLMDAISFVLGEKTSNLR 57 >BC080185-1|AAH80185.1| 417|Homo sapiens SMC1A protein protein. Length = 417 Score = 36.3 bits (80), Expect = 0.034 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = +3 Query: 189 VGRNGSGKSNFFHAIQFVLSDEFSHLR 269 +G NGSGKSN AI FVL ++ S+LR Sbjct: 31 IGPNGSGKSNLMDAISFVLGEKTSNLR 57 >BC064368-1|AAH64368.1| 847|Homo sapiens SMC1A protein protein. Length = 847 Score = 36.3 bits (80), Expect = 0.034 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = +3 Query: 189 VGRNGSGKSNFFHAIQFVLSDEFSHLR 269 +G NGSGKSN AI FVL ++ S+LR Sbjct: 31 IGPNGSGKSNLMDAISFVLGEKTSNLR 57 >AL161779-1|CAI42089.1| 1233|Homo sapiens structural maintenance of chromosomes 1A protein. Length = 1233 Score = 36.3 bits (80), Expect = 0.034 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = +3 Query: 189 VGRNGSGKSNFFHAIQFVLSDEFSHLR 269 +G NGSGKSN AI FVL ++ S+LR Sbjct: 31 IGPNGSGKSNLMDAISFVLGEKTSNLR 57 >BC126208-1|AAI26209.1| 1161|Homo sapiens SMC1B protein protein. Length = 1161 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = +3 Query: 189 VGRNGSGKSNFFHAIQFVLSDEFSHLR 269 +G NGSGKSN A+ FV+ ++ ++LR Sbjct: 31 IGPNGSGKSNVMDALSFVMGEKIANLR 57 >AL021391-1|CAI18928.1| 1235|Homo sapiens structural maintenance of chromosomes 1B protein. Length = 1235 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = +3 Query: 189 VGRNGSGKSNFFHAIQFVLSDEFSHLR 269 +G NGSGKSN A+ FV+ ++ ++LR Sbjct: 31 IGPNGSGKSNVMDALSFVMGEKIANLR 57 >AL008718-2|CAI17945.1| 1235|Homo sapiens structural maintenance of chromosomes 1B protein. Length = 1235 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = +3 Query: 189 VGRNGSGKSNFFHAIQFVLSDEFSHLR 269 +G NGSGKSN A+ FV+ ++ ++LR Sbjct: 31 IGPNGSGKSNVMDALSFVMGEKIANLR 57 >AJ504806-1|CAD43404.2| 1235|Homo sapiens SMC1beta protein protein. Length = 1235 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/27 (48%), Positives = 20/27 (74%) Frame = +3 Query: 189 VGRNGSGKSNFFHAIQFVLSDEFSHLR 269 +G NGSGKSN A+ FV+ ++ ++LR Sbjct: 31 IGPNGSGKSNVMDALSFVMGEKIANLR 57 >BC132750-1|AAI32751.1| 264|Homo sapiens hypothetical protein LOC196541 protein. Length = 264 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -2 Query: 160 LYNNLLSVTLECLGLLPVLCAVVF-V*IXKKLPKTKFYYD 44 L NLL TL+C LP + +V+ + K PK+ FYYD Sbjct: 149 LQYNLLKNTLQCTAHLPEVKELVWGEDLDKNFPKSAFYYD 188 >BC132748-1|AAI32749.1| 264|Homo sapiens hypothetical protein LOC196541 protein. Length = 264 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -2 Query: 160 LYNNLLSVTLECLGLLPVLCAVVF-V*IXKKLPKTKFYYD 44 L NLL TL+C LP + +V+ + K PK+ FYYD Sbjct: 149 LQYNLLKNTLQCTAHLPEVKELVWGEDLDKNFPKSAFYYD 188 >AL158063-3|CAH72181.1| 264|Homo sapiens protein ( Human DNA sequence from clone RP11-29B2 on chromosome 13 Contains the TPP2 gene for tripeptidyl peptidase II, a novel gene and 2 CpG ). Length = 264 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/40 (42%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -2 Query: 160 LYNNLLSVTLECLGLLPVLCAVVF-V*IXKKLPKTKFYYD 44 L NLL TL+C LP + +V+ + K PK+ FYYD Sbjct: 149 LQYNLLKNTLQCTAHLPEVKELVWGEDLDKNFPKSAFYYD 188 >BC122527-1|AAI22528.1| 377|Homo sapiens progestin and adipoQ receptor family member IX protein. Length = 377 Score = 29.9 bits (64), Expect = 2.9 Identities = 21/60 (35%), Positives = 26/60 (43%) Frame = -2 Query: 301 PRAVGPAAESGLRWENSSLSTN*MAWKKLLLPEPLRPTDYIMSFIKRLYNNLLSVTLECL 122 P A PAA R +S+ S + A K LL P D++ FI Y L ECL Sbjct: 15 PPAPAPAASGAARNSHSAASRDPPASAKPLLRWDEVPDDFVECFILSGYRRLPCTAQECL 74 >BC118666-1|AAI18667.1| 377|Homo sapiens progestin and adipoQ receptor family member IX protein. Length = 377 Score = 29.9 bits (64), Expect = 2.9 Identities = 21/60 (35%), Positives = 26/60 (43%) Frame = -2 Query: 301 PRAVGPAAESGLRWENSSLSTN*MAWKKLLLPEPLRPTDYIMSFIKRLYNNLLSVTLECL 122 P A PAA R +S+ S + A K LL P D++ FI Y L ECL Sbjct: 15 PPAPAPAASGAARNSHSAASRDPPASAKPLLRWDEVPDDFVECFILSGYRRLPCTAQECL 74 >AY424287-1|AAR08375.1| 377|Homo sapiens progestin and adipoQ receptor family member IX protein. Length = 377 Score = 29.9 bits (64), Expect = 2.9 Identities = 21/60 (35%), Positives = 26/60 (43%) Frame = -2 Query: 301 PRAVGPAAESGLRWENSSLSTN*MAWKKLLLPEPLRPTDYIMSFIKRLYNNLLSVTLECL 122 P A PAA R +S+ S + A K LL P D++ FI Y L ECL Sbjct: 15 PPAPAPAASGAARNSHSAASRDPPASAKPLLRWDEVPDDFVECFILSGYRRLPCTAQECL 74 >AK123932-1|BAC85729.1| 377|Homo sapiens protein ( Homo sapiens cDNA FLJ41938 fis, clone PERIC2006035. ). Length = 377 Score = 29.9 bits (64), Expect = 2.9 Identities = 21/60 (35%), Positives = 26/60 (43%) Frame = -2 Query: 301 PRAVGPAAESGLRWENSSLSTN*MAWKKLLLPEPLRPTDYIMSFIKRLYNNLLSVTLECL 122 P A PAA R +S+ S + A K LL P D++ FI Y L ECL Sbjct: 15 PPAPAPAASGAARNSHSAASRDPPASAKPLLRWDEVPDDFVECFILSGYRRLPCTAQECL 74 >BC007570-1|AAH07570.1| 649|Homo sapiens FBF1 protein protein. Length = 649 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = -2 Query: 334 QQKPK*L*GLFPRAVGPAAES 272 Q P L GLFPRA GPAA S Sbjct: 561 QDLPSSLVGLFPRAQGPAASS 581 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 53,147,175 Number of Sequences: 237096 Number of extensions: 1065043 Number of successful extensions: 2763 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 2742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2754 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2583773550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -