BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_O08 (476 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17465| Best HMM Match : Dpy-30 (HMM E-Value=0.05) 29 1.5 SB_25588| Best HMM Match : PAE (HMM E-Value=1.5e-31) 28 3.4 SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) 27 6.0 SB_49009| Best HMM Match : Ribosomal_S26e (HMM E-Value=7.3) 27 6.0 SB_33102| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 SB_6699| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.9 >SB_17465| Best HMM Match : Dpy-30 (HMM E-Value=0.05) Length = 249 Score = 29.5 bits (63), Expect = 1.5 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Frame = +2 Query: 206 IAGFATHLMRRLRHSQVRGISIKLQE--EERERRDNYVPEVSALEHDIIEVDPDTKDML 376 I + ++MR+ R + R ++ +LQE E++R+D E++ L I +D KD L Sbjct: 44 IRNLSRNIMRKWREAHERKVNKRLQELRIEKKRKDGEAKEIARLVTRKIPLDVLAKDWL 102 >SB_25588| Best HMM Match : PAE (HMM E-Value=1.5e-31) Length = 996 Score = 28.3 bits (60), Expect = 3.4 Identities = 11/37 (29%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = -2 Query: 400 NIVEVQHLQHILGVGVYFDDVMFESRHF--WDIVVTP 296 N+ ++ +H++ G D M E++HF W++V P Sbjct: 361 NLGSSRNYKHLMDAGGILSDKMHENKHFHSWNVVYVP 397 >SB_3226| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=0.021) Length = 1217 Score = 27.5 bits (58), Expect = 6.0 Identities = 15/61 (24%), Positives = 31/61 (50%) Frame = +2 Query: 164 EEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGISIKLQEEERERRDNYVPEVSALEHDI 343 + + +P++ LRN++ + L R + Q I K +EE+ + NY+ + EH + Sbjct: 456 KNLQAMPSEGLRNQLTLMSVALQRSIFTIQHDHIKAKKREEQEQMAQNYL-RTARKEHKL 514 Query: 344 I 346 + Sbjct: 515 M 515 >SB_49009| Best HMM Match : Ribosomal_S26e (HMM E-Value=7.3) Length = 163 Score = 27.5 bits (58), Expect = 6.0 Identities = 24/89 (26%), Positives = 45/89 (50%), Gaps = 7/89 (7%) Frame = +2 Query: 188 KPLRNKIAGFATHLMRRLRHSQVRGIS-IKLQEEERERRDNYVPEVS-ALEHDII-EVDP 358 K LR ++ FA+H RRLR + +R K+ + ++ Y P VS A+ II ++D Sbjct: 56 KALRGRVGLFASHCERRLRRTALRSRGWTKILKNHTLFQELY-PRVSRAISGTIIFDLDH 114 Query: 359 DTKDMLKMLD----FNNINGLQLTQPATQ 433 + + + D ++N + +P+T+ Sbjct: 115 KRRSTISLQDNTFPRQSLNAKSIAEPSTR 143 >SB_33102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 27.1 bits (57), Expect = 7.9 Identities = 18/58 (31%), Positives = 27/58 (46%) Frame = +2 Query: 35 KQRCTTSAMGRVRTKTVKXAAKLIIEKYYTXLTLDFDTNKRICEEIAIIPTKPLRNKI 208 +Q+ A+ R T + A LII YY + ++ + IIP K LR+KI Sbjct: 156 EQQKAFEALKRAITTARRPQAHLIIAPYYDLRAEIYTSDDVVLRLDKIIPPKSLRDKI 213 >SB_6699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1087 Score = 27.1 bits (57), Expect = 7.9 Identities = 13/48 (27%), Positives = 26/48 (54%) Frame = +2 Query: 227 LMRRLRHSQVRGISIKLQEEERERRDNYVPEVSALEHDIIEVDPDTKD 370 L +R RHS+ S + RE+ +++ ++ LE++ D DT++ Sbjct: 54 LEKRYRHSRKGTESHNTGTDTREKVLSHITQIQTLENESHNTDTDTRE 101 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,708,257 Number of Sequences: 59808 Number of extensions: 218078 Number of successful extensions: 575 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 560 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 575 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 989515521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -