BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_O08 (476 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 23 2.2 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 22.6 bits (46), Expect = 2.2 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = -3 Query: 417 VSCRPLILLKSSIFNISLVSGSTSMMSCSRADTSGT 310 ++C + L SS+ I+L G ++ +S +R +GT Sbjct: 215 INCTYVALYPSSVQVIALGVGVSNFLSSTRTAETGT 250 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 118,172 Number of Sequences: 438 Number of extensions: 2174 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12928545 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -