BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_O06 (502 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 25 0.34 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 22 3.1 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 9.5 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 21 9.5 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 21 9.5 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 21 9.5 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 21 9.5 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 21 9.5 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 25.4 bits (53), Expect = 0.34 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -1 Query: 169 FCFLRYRRAGWLNQVLTNLCQSLWKC 92 FC+ R A W N V NL SL KC Sbjct: 538 FCYFRRNAATWKNAVRHNL--SLHKC 561 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 22.2 bits (45), Expect = 3.1 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +2 Query: 194 SSTSCSWAVTSY 229 S + C+W +TSY Sbjct: 66 SGSKCTWTITSY 77 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 20.6 bits (41), Expect = 9.5 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 380 ESLQINVQRIKEYRARLILFPKGKKVLKGE 469 +S +IN++R+K+ +L + LKGE Sbjct: 492 KSSRINIERMKQVYQQLNKYRGNGVSLKGE 521 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 20.6 bits (41), Expect = 9.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 170 ILLSAVSSSWLVKPSFNKSLPILVE 96 I+ + + L S NKSLPIL E Sbjct: 12 IVCQGTTGNILRGESLNKSLPILHE 36 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 20.6 bits (41), Expect = 9.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 200 WSYGLSFLYSILLSAVSSSWL 138 WS L FL +L S+SW+ Sbjct: 292 WSGCLQFLVPMLQGFPSNSWV 312 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 20.6 bits (41), Expect = 9.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 200 WSYGLSFLYSILLSAVSSSWL 138 WS L FL +L S+SW+ Sbjct: 260 WSGCLQFLVPMLQGFPSNSWV 280 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 20.6 bits (41), Expect = 9.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 170 ILLSAVSSSWLVKPSFNKSLPILVE 96 I+ + + L S NKSLPIL E Sbjct: 12 IVCQGTTGNILRGESLNKSLPILHE 36 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 20.6 bits (41), Expect = 9.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 170 ILLSAVSSSWLVKPSFNKSLPILVE 96 I+ + + L S NKSLPIL E Sbjct: 12 IVCQGTTGNILRGESLNKSLPILHE 36 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,617 Number of Sequences: 438 Number of extensions: 2762 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13741392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -