BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_O05 (655 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7... 287 3e-79 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 25 1.6 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 25 2.1 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 25 2.1 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 24 3.7 U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. 23 8.4 >L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7 protein. Length = 192 Score = 287 bits (703), Expect = 3e-79 Identities = 136/169 (80%), Positives = 153/169 (90%) Frame = +2 Query: 140 QALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPMPKLKAFQKIQIRLVRELEK 319 QA++ELE NSDLK QLR+LYIT+A+E+E +NKK+IIIYVP+PK KAFQK+Q RLVRELEK Sbjct: 24 QAILELEMNSDLKPQLRDLYITRAREVEFNNKKAIIIYVPVPKQKAFQKVQTRLVRELEK 83 Query: 320 KFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRSRTLTSVYDAILEDLVFPAEIVGKRIR 499 KFSGKHVVF+ +R+ILPKP R NKQKRPRS +T+VYDAILEDLVFPAE+VGKRIR Sbjct: 84 KFSGKHVVFIAERRILPKPMRGRRDPNKQKRPRSPNVTAVYDAILEDLVFPAEVVGKRIR 143 Query: 500 VKLDGSQLIKVHLDKNQQTTIEHKVDTFQSVYKKLTGREVTFEFPEPYL 646 VKLDGSQLIKVHLDKNQQTTIEHKVDTF SVYKKLTGR+VTFEFPE YL Sbjct: 144 VKLDGSQLIKVHLDKNQQTTIEHKVDTFASVYKKLTGRDVTFEFPENYL 192 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 25.4 bits (53), Expect = 1.6 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -2 Query: 651 VYK*GSGNSKVTSRPVSFLYTDWKV 577 V K G G++ + RP+S L TD+K+ Sbjct: 507 VRKKGGGDAMSSIRPISLLNTDYKL 531 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 25.0 bits (52), Expect = 2.1 Identities = 20/57 (35%), Positives = 32/57 (56%) Frame = +2 Query: 428 LTSVYDAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTTIEHKVDTFQSVYK 598 L S Y+ ++ +V ++++ R+ +KL SQLI V+L KNQ T V+ YK Sbjct: 35 LLSNYNKLVRPVVNTSDVL--RVCIKLKLSQLIDVNL-KNQIMTTNLWVEQSWYDYK 88 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 25.0 bits (52), Expect = 2.1 Identities = 20/57 (35%), Positives = 32/57 (56%) Frame = +2 Query: 428 LTSVYDAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQTTIEHKVDTFQSVYK 598 L S Y+ ++ +V ++++ R+ +KL SQLI V+L KNQ T V+ YK Sbjct: 35 LLSNYNKLVRPVVNTSDVL--RVCIKLKLSQLIDVNL-KNQIMTTNLWVEQSWYDYK 88 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 24.2 bits (50), Expect = 3.7 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = -2 Query: 510 SNLTLMRLPTISAGKTKSSRIASYTEVNVLERGLFCLLATRVLWLGLGRIL 358 +N L+ +P + T SSR + L CLLAT V+W G++L Sbjct: 54 ANSRLVTVPAPAKELTDSSRSGGLPSSSS-SSSLSCLLATIVMWC-TGQVL 102 >U43500-1|AAA93303.1| 280|Anopheles gambiae a-CD36 protein. Length = 280 Score = 23.0 bits (47), Expect = 8.4 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -1 Query: 325 ELLFELTDKPDLDLLKGLQFRHRHIDDDR 239 ELLFE P LDLLK + +I D+ Sbjct: 96 ELLFEGVKDPLLDLLKTINSTSLNIPFDK 124 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 642,178 Number of Sequences: 2352 Number of extensions: 12419 Number of successful extensions: 37 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -