BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_O04 (543 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 3.5 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 3.5 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 21 8.1 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 3.5 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -1 Query: 198 VRPFFPSL*ICSFTSSAVNFXPGXGHCGGKAAPTG 94 V P P L + S TSS++ GH GG A+ TG Sbjct: 1403 VPPSAPVLYVTSSTSSSILLHWKSGHNGG-ASLTG 1436 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 3.5 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -1 Query: 198 VRPFFPSL*ICSFTSSAVNFXPGXGHCGGKAAPTG 94 V P P L + S TSS++ GH GG A+ TG Sbjct: 1399 VPPSAPVLYVTSSTSSSILLHWKSGHNGG-ASLTG 1432 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.0 bits (42), Expect = 8.1 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 Query: 122 CPXPGLKLTADDVKEQIY 175 CP +L DD+KE Y Sbjct: 338 CPKNNKELKYDDIKEMEY 355 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,541 Number of Sequences: 438 Number of extensions: 2972 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15459066 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -