BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_O01 (558 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 25 0.69 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 21 8.4 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 24.6 bits (51), Expect = 0.69 Identities = 16/77 (20%), Positives = 30/77 (38%), Gaps = 2/77 (2%) Frame = +2 Query: 269 IVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPS--VEDEV 442 +V E + A G+ +NG+ + + EP VE S+ P+ + Sbjct: 462 VVEEAACRFSAVAQAQLGGERQNGRKDSGYDGAASTAVIHEPVVETNSSPSPNPRIASAP 521 Query: 443 AVSEENNPSEDGSETNG 493 + S ++P G+ G Sbjct: 522 SSSTSSSPPAKGAAAAG 538 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.0 bits (42), Expect = 8.4 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -3 Query: 358 CCFLYFTILILSICVTGSFPSA 293 C F TI+ ++ + GS PSA Sbjct: 434 CVFFLTTIVSTTVILCGSPPSA 455 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,685 Number of Sequences: 438 Number of extensions: 1693 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16072521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -