BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_O01 (558 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g27470.1 68415.m03320 CCAAT-box binding transcription factor ... 44 7e-05 At1g72150.1 68414.m08342 SEC14 cytosolic factor family protein /... 44 9e-05 At5g65900.1 68418.m08295 DEAD/DEAH box helicase, putative contai... 43 1e-04 At4g25340.1 68417.m03647 immunophilin-related / FKBP-type peptid... 41 5e-04 At2g22795.1 68415.m02704 expressed protein 41 5e-04 At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains... 41 6e-04 At1g29470.1 68414.m03605 dehydration-responsive protein-related ... 40 9e-04 At1g56660.1 68414.m06516 expressed protein 40 0.001 At5g44610.1 68418.m05466 DREPP plasma membrane polypeptide-relat... 39 0.003 At3g48710.1 68416.m05319 expressed protein putative protein - Ar... 38 0.006 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 38 0.006 At1g15340.1 68414.m01835 methyl-CpG-binding domain-containing pr... 38 0.006 At5g45520.1 68418.m05591 hypothetical protein 37 0.008 At2g22080.1 68415.m02622 expressed protein 37 0.010 At1g69070.1 68414.m07903 expressed protein 36 0.014 At4g17910.1 68417.m02669 zinc finger (C3HC4-type RING finger) fa... 36 0.018 At3g51070.1 68416.m05592 dehydration-responsive protein-related ... 36 0.018 At4g07520.1 68417.m01174 hypothetical protein contains Pfam prof... 36 0.024 At2g12875.1 68415.m01402 hypothetical protein 35 0.032 At2g04970.1 68415.m00518 hypothetical protein similar to At2g152... 35 0.032 At1g60640.1 68414.m06826 expressed protein 35 0.032 At5g64030.1 68418.m08039 dehydration-responsive protein-related ... 34 0.056 At1g29000.1 68414.m03546 heavy-metal-associated domain-containin... 34 0.056 At1g03320.1 68414.m00311 hypothetical protein 34 0.056 At4g05410.1 68417.m00823 transducin family protein / WD-40 repea... 34 0.074 At1g17690.1 68414.m02190 expressed protein 34 0.074 At5g57120.1 68418.m07132 expressed protein weak similarity to SP... 33 0.098 At4g26630.1 68417.m03837 expressed protein 33 0.098 At4g08710.1 68417.m01439 hypothetical protein contains Pfam prof... 33 0.098 At3g30450.1 68416.m03852 hypothetical protein similar to At2g049... 33 0.098 At2g18540.1 68415.m02160 cupin family protein contains Pfam prof... 33 0.13 At5g55660.1 68418.m06940 expressed protein similar to unknown pr... 33 0.17 At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nic... 33 0.17 At4g34430.4 68417.m04893 DNA-binding family protein contains Pfa... 33 0.17 At4g34430.3 68417.m04892 DNA-binding family protein contains Pfa... 33 0.17 At4g34430.2 68417.m04891 DNA-binding family protein contains Pfa... 33 0.17 At4g34430.1 68417.m04890 DNA-binding family protein contains Pfa... 33 0.17 At3g42580.1 68416.m04420 Ulp1 protease family protein contains P... 33 0.17 At1g71470.1 68414.m08259 hypothetical protein 33 0.17 At5g41020.1 68418.m04986 myb family transcription factor contain... 32 0.23 At4g33740.2 68417.m04791 expressed protein 32 0.23 At4g33740.1 68417.m04790 expressed protein 32 0.23 At4g22320.1 68417.m03227 expressed protein 32 0.23 At3g57060.1 68416.m06353 non-SMC condensin subunit, XCAP-D2/Cnd1... 32 0.23 At5g63550.1 68418.m07976 expressed protein 32 0.30 At5g17980.1 68418.m02109 C2 domain-containing protein contains I... 32 0.30 At3g44750.1 68416.m04817 histone deacetylase, putative (HD2A) co... 32 0.30 At3g28770.1 68416.m03591 expressed protein 32 0.30 At5g27160.1 68418.m03241 hypothetical protein contains Pfam prof... 31 0.39 At5g02390.1 68418.m00162 expressed protein ; expression supporte... 31 0.39 At4g02400.1 68417.m00324 U3 ribonucleoprotein (Utp) family prote... 31 0.39 At2g30690.1 68415.m03742 expressed protein contains Pfam profile... 31 0.39 At1g67120.1 68414.m07636 midasin-related similar to Midasin (MID... 31 0.39 At1g08520.1 68414.m00943 magnesium-chelatase subunit chlD, chlor... 31 0.39 At5g61610.1 68418.m07731 glycine-rich protein / oleosin similar ... 31 0.52 At5g61150.1 68418.m07671 leo1-like family protein weak similarit... 31 0.52 At5g38720.1 68418.m04683 expressed protein predicted protein, Dr... 31 0.52 At3g56570.1 68416.m06290 SET domain-containing protein low simil... 31 0.52 At3g43530.1 68416.m04621 hypothetical protein contains Pfam prof... 31 0.52 At3g28510.1 68416.m03561 AAA-type ATPase family protein contains... 31 0.52 At2g14140.1 68415.m01575 hypothetical protein similar to At2g049... 31 0.52 At5g03740.1 68418.m00335 zinc finger (C2H2 type) family protein ... 31 0.69 At5g03710.1 68418.m00331 hypothetical protein 31 0.69 At4g37820.1 68417.m05351 expressed protein Kaposi's sarcoma-asso... 31 0.69 At1g76770.1 68414.m08934 heat shock protein-related contains sim... 31 0.69 At1g67580.1 68414.m07699 protein kinase family protein contains ... 31 0.69 At5g61150.2 68418.m07672 leo1-like family protein weak similarit... 30 0.91 At5g22650.2 68418.m02647 expressed protein non-consensus AT dono... 30 0.91 At5g22650.1 68418.m02646 expressed protein non-consensus AT dono... 30 0.91 At2g24990.1 68415.m02988 RIO1 family protein similar to extragen... 30 0.91 At1g80810.1 68414.m09481 expressed protein similar to androgen-i... 30 0.91 At1g01680.1 68414.m00086 U-box domain-containing protein 30 0.91 At3g62800.2 68416.m07056 double-stranded RNA-binding domain (DsR... 30 1.2 At3g62800.1 68416.m07055 double-stranded RNA-binding domain (DsR... 30 1.2 At1g76810.1 68414.m08938 eukaryotic translation initiation facto... 30 1.2 At5g53440.1 68418.m06641 expressed protein 29 1.6 At5g12410.1 68418.m01459 THUMP domain-containing protein contain... 29 1.6 At4g34400.1 68417.m04886 transcriptional factor B3 family protei... 29 1.6 At3g49990.1 68416.m05466 expressed protein 29 1.6 At3g49470.1 68416.m05407 nascent polypeptide-associated complex ... 29 1.6 At2g15860.1 68415.m01818 expressed protein and genefinder 29 1.6 At1g44810.1 68414.m05133 expressed protein contains Pfam profil... 29 1.6 At1g15940.1 68414.m01913 expressed protein similar To androgen-i... 29 1.6 At5g62750.1 68418.m07877 expressed protein predicted proteins, C... 29 2.1 At5g24880.1 68418.m02946 expressed protein ; expression supporte... 29 2.1 At5g10660.1 68418.m01234 calmodulin-binding protein-related cont... 29 2.1 At4g28080.1 68417.m04027 expressed protein 29 2.1 At4g04400.1 68417.m00634 hypothetical protein contains Pfam prof... 29 2.1 At3g12340.1 68416.m01538 immunophilin, putative / FKBP-type pept... 29 2.1 At1g21630.1 68414.m02708 calcium-binding EF hand family protein ... 29 2.1 At5g64910.1 68418.m08165 expressed protein ; expression support... 29 2.8 At5g61330.1 68418.m07696 rRNA processing protein-related contain... 29 2.8 At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RS... 29 2.8 At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RS... 29 2.8 At5g51300.2 68418.m06360 splicing factor-related contains simila... 29 2.8 At5g51300.1 68418.m06359 splicing factor-related contains simila... 29 2.8 At5g16500.1 68418.m01928 protein kinase family protein contains ... 29 2.8 At4g31880.1 68417.m04531 expressed protein 29 2.8 At4g29680.1 68417.m04228 type I phosphodiesterase/nucleotide pyr... 29 2.8 At4g26780.1 68417.m03857 co-chaperone grpE family protein simila... 29 2.8 At4g26110.1 68417.m03759 nucleosome assembly protein (NAP), puta... 29 2.8 At4g16830.1 68417.m02540 nuclear RNA-binding protein (RGGA) iden... 29 2.8 At3g49540.1 68416.m05414 expressed protein 29 2.8 At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar... 29 2.8 At1g18950.1 68414.m02358 aminoacyl-tRNA synthetase family contai... 29 2.8 At5g58590.1 68418.m07342 Ran-binding protein 1, putative / RanBP... 28 3.7 At5g37190.1 68418.m04465 COP1-interacting protein 4 (CIP4) simil... 28 3.7 At5g10950.1 68418.m01271 cylicin-related low similarity to SP|Q2... 28 3.7 At3g12380.1 68416.m01543 actin/actin-like family protein similar... 28 3.7 At3g05900.1 68416.m00664 neurofilament protein-related similar t... 28 3.7 At2g18220.1 68415.m02123 expressed protein contains Pfam domain ... 28 3.7 At2g02795.1 68415.m00223 hypothetical protein 28 3.7 At1g67180.1 68414.m07642 zinc finger (C3HC4-type RING finger) fa... 28 3.7 At1g64330.1 68414.m07290 myosin heavy chain-related similar to m... 28 3.7 At1g56110.1 68414.m06443 nucleolar protein Nop56, putative simil... 28 3.7 At1g48760.2 68414.m05457 delta-adaptin, putative similar to SP|O... 28 3.7 At1g48760.1 68414.m05456 delta-adaptin, putative similar to SP|O... 28 3.7 At1g23070.1 68414.m02884 hypothetical protein contains Pfam prof... 28 3.7 At5g66610.1 68418.m08396 LIM domain-containing protein contains ... 28 4.9 At5g63530.1 68418.m07974 copper chaperone (CCH)-related low simi... 28 4.9 At5g50830.1 68418.m06297 expressed protein 28 4.9 At5g13090.1 68418.m01500 expressed protein predicted proteins - ... 28 4.9 At4g32650.2 68417.m04648 inward rectifying potassium channel, pu... 28 4.9 At4g21900.1 68417.m03166 MATE efflux family protein similar to r... 28 4.9 At3g54760.1 68416.m06059 dentin sialophosphoprotein-related cont... 28 4.9 At3g01160.1 68416.m00020 expressed protein 28 4.9 At2g34300.1 68415.m04196 dehydration-responsive protein-related ... 28 4.9 At2g25670.2 68415.m03077 expressed protein 28 4.9 At2g25670.1 68415.m03076 expressed protein 28 4.9 At1g76780.1 68414.m08935 expressed protein ; expression supporte... 28 4.9 At1g09210.1 68414.m01028 calreticulin 2 (CRT2) identical to SP|Q... 28 4.9 At5g55920.1 68418.m06975 nucleolar protein, putative similar to ... 27 6.4 At5g48610.1 68418.m06012 expressed protein ; expression supporte... 27 6.4 At5g23420.1 68418.m02747 high mobility group (HMG1/2) family pro... 27 6.4 At4g37490.1 68417.m05305 G2/mitotic-specific cyclin (CYC1) / B-l... 27 6.4 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 27 6.4 At3g27600.1 68416.m03448 hypothetical protein 27 6.4 At3g23090.1 68416.m02911 expressed protein 27 6.4 At3g14670.1 68416.m01856 hypothetical protein 27 6.4 At2g33080.1 68415.m04056 leucine-rich repeat family protein cont... 27 6.4 At2g19520.1 68415.m02281 WD-40 repeat protein (MSI4) contains 6 ... 27 6.4 At2g17240.1 68415.m01991 expressed protein 27 6.4 At2g12400.1 68415.m01339 expressed protein 27 6.4 At1g76820.1 68414.m08939 expressed protein 27 6.4 At1g68920.1 68414.m07887 basic helix-loop-helix (bHLH) family pr... 27 6.4 At1g30280.1 68414.m03703 expressed protein contains low similari... 27 6.4 At1g15280.2 68414.m01829 glycine-rich protein 27 6.4 At1g15280.1 68414.m01828 glycine-rich protein 27 6.4 At1g01490.1 68414.m00065 heavy-metal-associated domain-containin... 27 6.4 At5g57160.1 68418.m07140 DNA ligase IV identical to DNA ligase I... 27 8.5 At5g40450.1 68418.m04905 expressed protein 27 8.5 At5g10490.1 68418.m01215 mechanosensitive ion channel domain-con... 27 8.5 At4g39550.1 68417.m05592 kelch repeat-containing F-box family pr... 27 8.5 At4g26600.1 68417.m03834 nucleolar protein, putative similar to ... 27 8.5 At3g57930.1 68416.m06457 expressed protein 27 8.5 At3g55020.1 68416.m06110 RabGAP/TBC domain-containing protein lo... 27 8.5 At3g52140.1 68416.m05723 tetratricopeptide repeat (TPR)-containi... 27 8.5 At3g50370.1 68416.m05508 expressed protein 27 8.5 At3g48060.1 68416.m05240 bromo-adjacent homology (BAH) domain-co... 27 8.5 At3g48050.2 68416.m05239 bromo-adjacent homology (BAH) domain-co... 27 8.5 At3g48050.1 68416.m05238 bromo-adjacent homology (BAH) domain-co... 27 8.5 At3g45230.1 68416.m04881 hydroxyproline-rich glycoprotein family... 27 8.5 At3g13700.1 68416.m01731 RNA-binding protein, putative similar t... 27 8.5 At2g38910.1 68415.m04783 calcium-dependent protein kinase, putat... 27 8.5 At1g76720.1 68414.m08929 eukaryotic translation initiation facto... 27 8.5 At1g43100.1 68414.m04965 glycoside hydrolase family 28 protein /... 27 8.5 At1g43090.1 68414.m04964 glycoside hydrolase family 28 protein /... 27 8.5 At1g26650.1 68414.m03245 expressed protein 27 8.5 >At2g27470.1 68415.m03320 CCAAT-box binding transcription factor subunit HAP3-related contains Pfam PF00808 : Histone-like transcription factor (CBF/NF-Y) and archaeal histone; similar to polymerase epsilon p17 subunit (DNA polymerase epsilon subunit 3) (YB-like protein 1) (YBL1) (NF-YB-like protein) (SP:Q9JKP7) [Mus musculus]; Length = 275 Score = 44.0 bits (99), Expect = 7e-05 Identities = 36/127 (28%), Positives = 56/127 (44%) Frame = +2 Query: 176 DNDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEET 355 + + +KG K+K+ D ET+ + E + N +E++ + + +DEN E T Sbjct: 140 EEPSTQKGARKSKI--DEETKRNDEETENDN--TEEENGNDEEDENGNDEEDENDD-ENT 194 Query: 356 APKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVPSG*GT* 535 ++N +E EN + +E EDE EEN + S H EE SG G Sbjct: 195 EENGNDEENDDENTEENGNDEENEKEDEENSMEENGNESEESGNEDHSMEEN-GSGVGED 253 Query: 536 ETNXKGS 556 N GS Sbjct: 254 NENEDGS 260 Score = 36.7 bits (81), Expect = 0.010 Identities = 28/97 (28%), Positives = 46/97 (47%), Gaps = 2/97 (2%) Frame = +2 Query: 224 DPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVE 403 D E E+ E DE + E + G D +ENG EE K+ + ++EE E Sbjct: 176 DEEDENGNDEEDEND--DENTEENGNDEENDDENTEENGNDEENE-KEDEENSMEENGNE 232 Query: 404 NXST--DEPSVEDEVAVSEENNPSEDGSETNGHIEEE 508 + + ++ S+E+ + E+N +EDGS + E E Sbjct: 233 SEESGNEDHSMEENGSGVGEDNENEDGSVSGSGEEVE 269 Score = 34.3 bits (75), Expect = 0.056 Identities = 28/106 (26%), Positives = 48/106 (45%), Gaps = 5/106 (4%) Frame = +2 Query: 206 KAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRK-KN 382 K K + + E + + +++TKR + + N ++ENG EE + +N Sbjct: 130 KPKETKKRKQEEPSTQKGARKSKIDEETKRNDEETENDNTEEENGNDEEDENGNDEEDEN 189 Query: 383 VEEPPVENXSTDEPSVED-EVAVSEENNPSED---GSETNGHIEEE 508 +E EN + +E E+ E ++E N ED E NG+ EE Sbjct: 190 DDENTEENGNDEENDDENTEENGNDEENEKEDEENSMEENGNESEE 235 Score = 32.3 bits (70), Expect = 0.23 Identities = 19/83 (22%), Positives = 40/83 (48%), Gaps = 6/83 (7%) Frame = +2 Query: 281 KKTKRGRKAAGDTNGQDENGKIEETA------PKKGRKKNVEEPPVENXSTDEPSVEDEV 442 KK G+KA G +++ PK+ +K+ EEP + + + +++E Sbjct: 99 KKKNAGKKAGAAAASYPAGGAALKSSSGTASKPKETKKRKQEEPSTQKGAR-KSKIDEET 157 Query: 443 AVSEENNPSEDGSETNGHIEEEQ 511 ++E +++ E NG+ EE++ Sbjct: 158 KRNDEETENDNTEEENGNDEEDE 180 >At1g72150.1 68414.m08342 SEC14 cytosolic factor family protein / phosphoglyceride transfer family protein similar to SEC14-like protein 2 (Alpha-tocopherol associated protein) (TAP) (bTAP) (Fragment) (SP:P58875) {Bos taurus}; similar to GI:807956 from [Saccharomyces cerevisiae]; contains Pfam PF00650 : CRAL/TRIO domain; contains Pfam PF03765 : CRAL/TRIO, N-terminus Length = 573 Score = 43.6 bits (98), Expect = 9e-05 Identities = 30/99 (30%), Positives = 46/99 (46%), Gaps = 3/99 (3%) Frame = +2 Query: 227 PETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEE---TAPKKGRKKNVEEPP 397 P T E + +EK +E++TK K K+EE P +K+ E P Sbjct: 116 PVTPVKEEKTEEKK--TEEETKEEEKTEEKKEETTTEVKVEEEKPAVPAAEEEKSSEAAP 173 Query: 398 VENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQV 514 VE S ++P + EV + ++ EDG++T IEE V Sbjct: 174 VETKSEEKPEEKAEVTTEKASSAEEDGTKTVEAIEESIV 212 Score = 30.3 bits (65), Expect = 0.91 Identities = 34/146 (23%), Positives = 60/146 (41%) Frame = +2 Query: 74 SNKTVTVITKTNISS*IMAPRSXXXXXXXXXXXXDNDAPKKGRGKAKVVEDPETESVEAE 253 ++K VT+ T + AP S + +AP K+ V++ ET V + Sbjct: 24 TDKEVTIPTPVAEKEEVAAPVSDEKAVPEKEVTPEKEAPAAEAEKSVSVKEEETVVVAEK 83 Query: 254 VDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVE 433 V + +E+ K+ + + + N K E TAP PV+ T+E E Sbjct: 84 V--VVLTAEEVQKKALEEFKELVREALN-KREFTAP---------VTPVKEEKTEEKKTE 131 Query: 434 DEVAVSEENNPSEDGSETNGHIEEEQ 511 +E E+ ++ + T +EEE+ Sbjct: 132 EETKEEEKTEEKKEETTTEVKVEEEK 157 >At5g65900.1 68418.m08295 DEAD/DEAH box helicase, putative contains Pfam profiles PF00270:DEAD/DEAH box helicase and PF00271: Helicase conserved C-terminal domain; identical to cDNA RH27 helicase, partial GI:4033334 Length = 633 Score = 43.2 bits (97), Expect = 1e-04 Identities = 32/102 (31%), Positives = 49/102 (48%) Frame = +2 Query: 176 DNDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEET 355 D + KK + K K D + EA +E+ +KK K+ ++ GDTN +++ EE Sbjct: 56 DEEPKKKKKKKNKKRGDTDDGEDEAVAEEEPKKKKKKNKKLQQR-GDTNDEEDEVIAEEE 114 Query: 356 APKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGS 481 PKK +KK + T+ S E+EV EE E+ S Sbjct: 115 EPKKKKKK-------QRKDTEAKSEEEEVEDKEEEKKLEETS 149 Score = 29.9 bits (64), Expect = 1.2 Identities = 16/67 (23%), Positives = 33/67 (49%) Frame = +2 Query: 314 DTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNG 493 D + ++ N I+E KK +KKN + ++ + + E+ ++N + +TN Sbjct: 45 DGDAKENNALIDEEPKKKKKKKNKKRGDTDDGEDEAVAEEEPKKKKKKNKKLQQRGDTND 104 Query: 494 HIEEEQV 514 EE++V Sbjct: 105 --EEDEV 109 >At4g25340.1 68417.m03647 immunophilin-related / FKBP-type peptidyl-prolyl cis-trans isomerase-related immunophilin FKBP46 - Spodoptera frugiperda (fall armyworm),PIR2:A55320 Length = 477 Score = 41.1 bits (92), Expect = 5e-04 Identities = 31/116 (26%), Positives = 51/116 (43%), Gaps = 2/116 (1%) Frame = +2 Query: 176 DNDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEET 355 D D +GK+ VE+ E + + DE+ S KK K KAA +GQ+ K ++ Sbjct: 213 DEDGLPIPKGKSSEVENASGEKMVVDNDEQG--SNKKRK--AKAAEQDDGQESANKSKKK 268 Query: 356 APKKGRKK--NVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVP 517 +K +KK NV T + +++ N ++DG+ N E + P Sbjct: 269 KNQKEKKKGENVLNEEAGQVQTGNVLKKQDISQISSNTKAQDGTANNAMSESSKTP 324 >At2g22795.1 68415.m02704 expressed protein Length = 734 Score = 41.1 bits (92), Expect = 5e-04 Identities = 29/111 (26%), Positives = 47/111 (42%) Frame = +2 Query: 191 KKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKG 370 +K G + E TE E E + N +E+ K G + + + + ENG EE Sbjct: 168 RKDNGGTEENEKSGTEESEVEERKDNGGTEENEKSGTEES-EVEERKENGGTEENEKSGS 226 Query: 371 RKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVPSG 523 + VEE +N T+E + SE ++GS +EE++ G Sbjct: 227 EESEVEEKK-DNGGTEESREKSGTEESEVEEKKDNGSSEESEVEEKKENRG 276 Score = 37.5 bits (83), Expect = 0.006 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 3/103 (2%) Frame = +2 Query: 191 KKGRGKAKVVEDPE---TESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAP 361 K G +++V E E TE E E++ V EKK G + + + +G +E+ ++EE Sbjct: 201 KSGTEESEVEERKENGGTEENEKSGSEESEVEEKKDNGGTEESREKSGTEES-EVEEKKD 259 Query: 362 KKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETN 490 +++ E EN DE E + E+ N E+ E N Sbjct: 260 NGSSEESEVEEKKENRGIDESEESKEKDIDEKAN-IEEARENN 301 Score = 36.3 bits (80), Expect = 0.014 Identities = 29/117 (24%), Positives = 52/117 (44%), Gaps = 5/117 (4%) Frame = +2 Query: 221 EDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPV 400 ++ E+E + + D + + EKK G + + +D G EE K G +++ E Sbjct: 111 KEKESEGIVSNEDSNSEIEEKKDSGGVEESEVEEKRDNGGGTEEN-EKSGTEESEVEERK 169 Query: 401 ENXSTDE----PSVEDEVAVSEENNPSEDGSETNGHIEE-EQVPSG*GT*ETNXKGS 556 +N T+E + E EV ++N +E+ ++ E E+ GT E GS Sbjct: 170 DNGGTEENEKSGTEESEVEERKDNGGTEENEKSGTEESEVEERKENGGTEENEKSGS 226 Score = 32.3 bits (70), Expect = 0.23 Identities = 31/124 (25%), Positives = 51/124 (41%), Gaps = 6/124 (4%) Frame = +2 Query: 203 GKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKG-RKK 379 G VVE S + E IV + + +++ G + +D N +IEE G + Sbjct: 83 GSKNVVES--FNSGNGDDKENEIVEGGEENKEKESEGIVSNEDSNSEIEEKKDSGGVEES 140 Query: 380 NVEEPPVENXSTDE----PSVEDEVAVSEENNPSEDGSETNGHIEE-EQVPSG*GT*ETN 544 VEE T+E + E EV ++N +E+ ++ E E+ GT E Sbjct: 141 EVEEKRDNGGGTEENEKSGTEESEVEERKDNGGTEENEKSGTEESEVEERKDNGGTEENE 200 Query: 545 XKGS 556 G+ Sbjct: 201 KSGT 204 Score = 31.5 bits (68), Expect = 0.39 Identities = 28/114 (24%), Positives = 47/114 (41%), Gaps = 1/114 (0%) Frame = +2 Query: 176 DNDAPKKGRGKAKVVEDP-ETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEE 352 +N+ K + ++ E+ E E+ + E +E E K K K ++E+ EE Sbjct: 560 ENETETKEKEESSSQEETKEKENEKIEKEESAPQEETKEKENEKIE-----KEESASQEE 614 Query: 353 TAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQV 514 T K+ K EE N S + + E E E N + +T+ +E V Sbjct: 615 TKEKETETKEKEESS-SNESQENVNTESEKKEQVEENEKKTDEDTSESSKENSV 667 Score = 27.9 bits (59), Expect = 4.9 Identities = 23/89 (25%), Positives = 39/89 (43%) Frame = +2 Query: 224 DPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVE 403 D ES E ++DEK + E + + GD + + EE + + VE+ Sbjct: 278 DESEESKEKDIDEKANIEEARENNYK---GDDASSEVVHESEEKTSESENSEKVEDK--S 332 Query: 404 NXSTDEPSVEDEVAVSEENNPSEDGSETN 490 T+E VED V S N +++G ++ Sbjct: 333 GIKTEE--VEDSVIKSVLPNTTDNGESSS 359 >At2g03150.1 68415.m00268 ATP/GTP-binding protein family contains ATP/GTP-binding site motif A (P-loop), PROSITE:PS00017 Length = 1340 Score = 40.7 bits (91), Expect = 6e-04 Identities = 26/106 (24%), Positives = 47/106 (44%), Gaps = 1/106 (0%) Frame = +2 Query: 191 KKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKG 370 K+ GK V E EA K + K+ G + QDE + P++ Sbjct: 1110 KETSGKETVDGSREIADKEAVAKTKETLGSKEVTVGEAVNMEVENQDEEDDDGDDDPEED 1169 Query: 371 RKKNVEEPPVENXSTDEPSVED-EVAVSEENNPSEDGSETNGHIEE 505 +++ EE P E+ D E+ +VA +E+ P+E+ + ++E+ Sbjct: 1170 PEEDPEEDPEEDPEEDPEECEEMDVANTEQEEPAEEPQKKEENLEK 1215 Score = 35.1 bits (77), Expect = 0.032 Identities = 19/82 (23%), Positives = 37/82 (45%) Frame = +2 Query: 209 AKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVE 388 A+ +ED + E+ VD K TK+ A+ + + G+ ++ K + E Sbjct: 883 AESLEDVKDENASKTVDVKQETGSPDTKKKEGASSSSKKDTKTGEDKKAEKKNNSETMSE 942 Query: 389 EPPVENXSTDEPSVEDEVAVSE 454 ++ +TDE V+++V E Sbjct: 943 GKKIDRNNTDEKEVKEKVTEKE 964 >At1g29470.1 68414.m03605 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 770 Score = 40.3 bits (90), Expect = 9e-04 Identities = 31/97 (31%), Positives = 41/97 (42%), Gaps = 2/97 (2%) Frame = +2 Query: 224 DPETESVEAEVDEKNIVSEKKTKRGRKAAGDT-NGQDENGKIEETAPKKGRKKN-VEEPP 397 DPE E ++ E+K + GD NG E E+ K ++K +EE Sbjct: 98 DPEKSGEENSGEKTESAEERKEFDDKNGDGDRKNGDGEKDTESESDETKQKEKTQLEESS 157 Query: 398 VENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEE 508 EN S D E+ SEEN +E SE N EE Sbjct: 158 EENKSEDSNGTEENAGESEEN--TEKKSEENAGETEE 192 Score = 33.9 bits (74), Expect = 0.074 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 1/82 (1%) Frame = +2 Query: 221 EDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDEN-GKIEETAPKKGRKKNVEEPP 397 +D E+ES E + EK + E + + D+NG +EN G+ EE KK + E Sbjct: 136 KDTESESDETKQKEKTQLEESSEENKSE---DSNGTEENAGESEENTEKKSEENAGETEE 192 Query: 398 VENXSTDEPSVEDEVAVSEENN 463 S D D+ +++E++ Sbjct: 193 STEKSKDVFPAGDQAEITKESS 214 Score = 31.5 bits (68), Expect = 0.39 Identities = 28/99 (28%), Positives = 43/99 (43%), Gaps = 5/99 (5%) Frame = +2 Query: 227 PETESVEAEV-DEKNIVSEKKTKRGRKAAGD-TNGQDENGKIEETAPKKGRKKNVEEPPV 400 P+ ++ E EV E N K G + +G+ T +E + ++ RK E Sbjct: 79 PDEKNEETEVVTETNEEKTDPEKSGEENSGEKTESAEERKEFDDKNGDGDRKNGDGEKDT 138 Query: 401 ENXSTDEPSVE-DEVAVSEENNPSED--GSETNGHIEEE 508 E+ S + E ++ S E N SED G+E N EE Sbjct: 139 ESESDETKQKEKTQLEESSEENKSEDSNGTEENAGESEE 177 Score = 31.5 bits (68), Expect = 0.39 Identities = 27/113 (23%), Positives = 53/113 (46%), Gaps = 1/113 (0%) Frame = +2 Query: 188 PKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQ-DENGKIEETAPK 364 P+K G+ E E+ E D+KN ++K G K DT + DE + E+T + Sbjct: 99 PEKS-GEENSGEKTESAEERKEFDDKNGDGDRKNGDGEK---DTESESDETKQKEKTQLE 154 Query: 365 KGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVPSG 523 + ++N E ++ T+E + E E +++ + +E + ++ P+G Sbjct: 155 ESSEENKSE---DSNGTEENAGESEENTEKKSEENAGETEESTEKSKDVFPAG 204 >At1g56660.1 68414.m06516 expressed protein Length = 522 Score = 39.5 bits (88), Expect = 0.001 Identities = 29/112 (25%), Positives = 52/112 (46%), Gaps = 1/112 (0%) Frame = +2 Query: 176 DNDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEET 355 D+D K G+ +K E+ + E D K EK+ K+G++ + +++ GK Sbjct: 78 DDDKKKDGKMVSKKHEEGHGDLEVKESDVKVEEHEKEHKKGKEKKHEELEEEKEGK---- 133 Query: 356 APKKGRKKNVEEPPVE-NXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEE 508 KK +K+ E P E N D+ ++V+ +E EDG + ++E Sbjct: 134 -KKKNKKEKDESGPEEKNKKADKEKKHEDVSQEKEELEEEDGKKNKKKEKDE 184 Score = 33.1 bits (72), Expect = 0.13 Identities = 30/116 (25%), Positives = 54/116 (46%), Gaps = 10/116 (8%) Frame = +2 Query: 191 KKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIE--ETAPK 364 KK + K K ++ ++E E + D+K + +K+ + GD ++ + K+E E K Sbjct: 58 KKDKEKKKG-KNVDSEVKEDKDDDKKKDGKMVSKKHEEGHGDLEVKESDVKVEEHEKEHK 116 Query: 365 KGRKKNVEEPPVE--------NXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEE 508 KG++K EE E DE E++ +++ ED S+ +EEE Sbjct: 117 KGKEKKHEELEEEKEGKKKKNKKEKDESGPEEKNKKADKEKKHEDVSQEKEELEEE 172 Score = 32.7 bits (71), Expect = 0.17 Identities = 30/115 (26%), Positives = 55/115 (47%), Gaps = 14/115 (12%) Frame = +2 Query: 191 KKGRGKAKVVEDPETES-VEAEVDEKNIV-----SEKK----TKRGRKAAGDTNGQDENG 340 K +G+ V ED + E+ +E EV ++I +EKK T+ +K+ + +E Sbjct: 369 KSEKGEKDVKEDKKKENPLETEVMSRDIKLEEPEAEKKEEDDTEEKKKSKVEGGESEEGK 428 Query: 341 KIEETAPKKGRKKNVEEPPV----ENXSTDEPSVEDEVAVSEENNPSEDGSETNG 493 K ++ KK +KK+ +EP + E D V+ E + ++E +D + G Sbjct: 429 KKKKKDKKKNKKKDTKEPKMTEDEEEKKDDSKDVKIEGSKAKEEKKDKDVKKKKG 483 Score = 31.1 bits (67), Expect = 0.52 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 2/97 (2%) Frame = +2 Query: 191 KKGRGKA--KVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPK 364 KKG+ K ++ E+ E + + + ++ E+K K+ K + E ++EE K Sbjct: 116 KKGKEKKHEELEEEKEGKKKKNKKEKDESGPEEKNKKADKEKKHEDVSQEKEELEEEDGK 175 Query: 365 KGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSED 475 K +KK +E E +P E + EE+ +ED Sbjct: 176 KNKKKEKDESGTEE-KKKKPKKEKK--QKEESKSNED 209 Score = 28.7 bits (61), Expect = 2.8 Identities = 24/101 (23%), Positives = 43/101 (42%), Gaps = 6/101 (5%) Frame = +2 Query: 191 KKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIE-----ET 355 K G + + P+ E + E + N + K K+ + GD +DE K E + Sbjct: 182 KDESGTEEKKKKPKKEKKQKEESKSNEDKKVKGKKEKGEKGDLEKEDEEKKKEHDETDQE 241 Query: 356 APKKGRKKNVEEPPVENXSTDEPSVED-EVAVSEENNPSED 475 +K KKN ++ E+ + ++ D E +E+ ED Sbjct: 242 MKEKDSKKNKKKEKDESCAEEKKKKPDKEKKEKDESTEKED 282 Score = 28.3 bits (60), Expect = 3.7 Identities = 22/97 (22%), Positives = 44/97 (45%), Gaps = 4/97 (4%) Frame = +2 Query: 206 KAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRK--- 376 K ++ E+ ++ + E DE +KK + K + + +E+ K++ +KG K Sbjct: 166 KEELEEEDGKKNKKKEKDESGTEEKKKKPKKEKKQKEESKSNEDKKVKGKK-EKGEKGDL 224 Query: 377 -KNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSE 484 K EE E+ TD+ E + +++ E +E Sbjct: 225 EKEDEEKKKEHDETDQEMKEKDSKKNKKKEKDESCAE 261 >At5g44610.1 68418.m05466 DREPP plasma membrane polypeptide-related contains Pfam profile: PF05558 DREPP plasma membrane polypeptide Length = 168 Score = 38.7 bits (86), Expect = 0.003 Identities = 32/109 (29%), Positives = 51/109 (46%), Gaps = 2/109 (1%) Frame = +2 Query: 191 KKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKG 370 +K K +VVE+ + VE V+E + +E+ K G + E +IE KK Sbjct: 17 EKSPAKKEVVEEEKPREVEV-VEEVVVKTEEPAKEGETKPEEIIATGEK-EIEIVEEKKE 74 Query: 371 RKKNVEEPPVENXSTDEPSVEDE--VAVSEENNPSEDGSETNGHIEEEQ 511 K VE P + +P+VE+E A EE P+ + E +EE++ Sbjct: 75 EAKPVEVPVLAAAEEKKPAVEEEKKTAPVEEKKPAVE-EEKKPAVEEKK 122 >At3g48710.1 68416.m05319 expressed protein putative protein - Arabidopsis thaliana, EMBL:AL078465.1 Length = 462 Score = 37.5 bits (83), Expect = 0.006 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 7/74 (9%) Frame = +2 Query: 275 SEKKTKRGRKAAGD--TNGQDEN--GKIEETAPKKGRKKNVE---EPPVENXSTDEPSVE 433 SEK+TK+ +K+ T+G+ + K A K+ + E E V + T++ + E Sbjct: 210 SEKETKKRKKSTSKNVTSGESSHVPAKRRRQAKKQEQPTETEGNGESDVGSEGTNDSNGE 269 Query: 434 DEVAVSEENNPSED 475 D+VA EENN SED Sbjct: 270 DDVAPEEENNKSED 283 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 37.5 bits (83), Expect = 0.006 Identities = 28/101 (27%), Positives = 47/101 (46%), Gaps = 1/101 (0%) Frame = +2 Query: 185 APKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPK 364 A K + AK + +S E DEK ++K KAA ++ DE+ EE+ + Sbjct: 173 AAKIAKPAAKDSSSSDDDSDEDSEDEKP-ATKKAAPAAAKAASSSDSSDEDSD-EESEDE 230 Query: 365 KGRKKNVEEPPVENXSTDEPS-VEDEVAVSEENNPSEDGSE 484 K +K + + S+DE S E++ + EE P + S+ Sbjct: 231 KPAQKKADTKASKKSSSDESSESEEDESEDEEETPKKKSSD 271 >At1g15340.1 68414.m01835 methyl-CpG-binding domain-containing protein contains Pfam profile PF01429: Methyl-CpG binding domain Length = 384 Score = 37.5 bits (83), Expect = 0.006 Identities = 29/109 (26%), Positives = 46/109 (42%) Frame = +2 Query: 176 DNDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEET 355 +N +K + K V E E E E ++ +EK K G K GQ E + E+ Sbjct: 135 ENAEAEKEKEKEGVTEIAEAEKENNEGEKTE--AEKVNKEGEKTEAGKEGQTEIAEAEKE 192 Query: 356 APKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIE 502 K+G K E E + S+E + + E+ S +G+E +E Sbjct: 193 --KEGEKAEAENKEAEVVRDKKESMEVDTSELEKKAGSGEGAEEPSKVE 239 >At5g45520.1 68418.m05591 hypothetical protein Length = 1167 Score = 37.1 bits (82), Expect = 0.008 Identities = 34/120 (28%), Positives = 52/120 (43%), Gaps = 17/120 (14%) Frame = +2 Query: 200 RGKAKVVEDPETESVEAEVDEKNIVSE------KKTKRGRKAAGDTNGQ--DENGKIEET 355 +GKA + E+ + + VEAE + + + E K+K +K GD DE K +E Sbjct: 681 KGKADLEEEKKQDEVEAEKSKSDEIVEGEKKPDDKSKVEKKGDGDKENADLDEGKKRDEV 740 Query: 356 APKKGRKKNV------EEPPVENXSTDEPSVEDEVAVSEENNPSE---DGSETNGHIEEE 508 KK V E PP E+ T + +D+ V +E + + D E H E E Sbjct: 741 EAKKSESGKVVEGDGKESPPQESIDTIQNMTDDQTKVEKEGDRDKGKVDPEEGKKHDEVE 800 >At2g22080.1 68415.m02622 expressed protein Length = 177 Score = 36.7 bits (81), Expect = 0.010 Identities = 18/68 (26%), Positives = 34/68 (50%) Frame = +2 Query: 308 AGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSET 487 +GD G+DE G ++ K+ +K V +P + + D +DE + N+ +D + Sbjct: 71 SGDDGGEDEEGSADDAEGKETKKGPVSDPDLNGEAGDN---DDEPEGDDGNDDEDDDNHE 127 Query: 488 NGHIEEEQ 511 N +EE+ Sbjct: 128 NDDEDEEE 135 Score = 29.9 bits (64), Expect = 1.2 Identities = 24/97 (24%), Positives = 38/97 (39%) Frame = +2 Query: 221 EDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPV 400 +D + E E + K+TK+G + D NG E G ++ + ++ Sbjct: 69 DDSGDDGGEDEEGSADDAEGKETKKGPVSDPDLNG--EAGDNDDEPEGDDGNDDEDDDNH 126 Query: 401 ENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 511 EN DE EDE E + ED EE++ Sbjct: 127 ENDDEDEEEDEDENDDGGEEDDDEDAEVEEEEEEEDE 163 >At1g69070.1 68414.m07903 expressed protein Length = 901 Score = 36.3 bits (80), Expect = 0.014 Identities = 33/111 (29%), Positives = 56/111 (50%), Gaps = 4/111 (3%) Frame = +2 Query: 191 KKGRGKAKVVEDPET----ESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETA 358 +K R K + +E+ E+ E ++ I E+ TKR +GD G ++ +EE Sbjct: 281 QKEREKLEALEEERKKRMQETEELSDGDEEIGGEESTKRLTVISGDDLG--DSFSVEEDK 338 Query: 359 PKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 511 PK+G +V E E+ + S EDE + SEE +D E++G E+++ Sbjct: 339 PKRGWIDDVLER--EDNVDNSESDEDEDSESEEE--EDDDGESDGGDEKQR 385 >At4g17910.1 68417.m02669 zinc finger (C3HC4-type RING finger) family protein / pentatricopeptide (PPR) repeat-containing protein contains Pfam domains PF01535: PPR repeat and PF00097: Zinc finger, C3HC4 type (RING finger) Length = 1208 Score = 35.9 bits (79), Expect = 0.018 Identities = 29/90 (32%), Positives = 43/90 (47%) Frame = +2 Query: 239 SVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTD 418 S E+E + I+ E R + A + +DEN E+ +P+ N+ EP EN S + Sbjct: 436 SSESEDERVTIIREADMNR-EEVAEENKFEDEN--CEQESPE-----NLNEPEEENISEE 487 Query: 419 EPSVEDEVAVSEENNPSEDGSETNGHIEEE 508 +VE + E NP E+ E G EEE Sbjct: 488 GDNVEPMQSQGMEENPEEE--EKEGEEEEE 515 >At3g51070.1 68416.m05592 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 895 Score = 35.9 bits (79), Expect = 0.018 Identities = 28/88 (31%), Positives = 40/88 (45%) Frame = +2 Query: 230 ETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENX 409 E S E ++N EK T G+ + +DENG+ EE + N EE E+ Sbjct: 245 EQNSGNEETGQQN--EEKTTASEENGKGEKSMKDENGQQEEHTTAEEESGNKEE---EST 299 Query: 410 STDEPSVEDEVAVSEENNPSEDGSETNG 493 S DE + E E+ + E GSE +G Sbjct: 300 SKDENMEQQEERKDEKKH--EQGSEASG 325 Score = 28.3 bits (60), Expect = 3.7 Identities = 26/115 (22%), Positives = 49/115 (42%), Gaps = 5/115 (4%) Frame = +2 Query: 179 NDAPKKGRGKA-KVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGD---TNGQDENGKI 346 ++ +K GK + V++ E ++ V K E+K +R A T GQ++ Sbjct: 134 SEEKEKDNGKENQTVQESEEGQMKKVV--KEFEKEQKQQRDEDAGTQPKGTQGQEQGQGK 191 Query: 347 EETAPKKGRKKNVEEPPVENXS-TDEPSVEDEVAVSEENNPSEDGSETNGHIEEE 508 E+ ++G K+ E+ + + TD E + + +E NG EE+ Sbjct: 192 EQPDVEQGNKQGQEQDSNTDVTFTDATKQEQPMETGQGETSETSKNEENGQPEEQ 246 >At4g07520.1 68417.m01174 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 734 Score = 35.5 bits (78), Expect = 0.024 Identities = 29/90 (32%), Positives = 39/90 (43%) Frame = +2 Query: 239 SVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTD 418 S E+E + I+ E R AA + +DEN E+ PK N+ EP E S + Sbjct: 11 SSESEDERVTIIREADMNREEVAAEENKFEDEN--CEQEPPK-----NLHEPEEEKISEE 63 Query: 419 EPSVEDEVAVSEENNPSEDGSETNGHIEEE 508 E + E NP E+ E G EEE Sbjct: 64 VDDEEPMQSQGMEENPEEE--EKEGEEEEE 91 Score = 27.9 bits (59), Expect = 4.9 Identities = 18/104 (17%), Positives = 40/104 (38%), Gaps = 2/104 (1%) Frame = +2 Query: 206 KAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAP--KKGRKK 379 + ++ + + E +E E + K + + + ++++ P +G ++ Sbjct: 18 RVTIIREADMNREEVAAEENKFEDENCEQEPPKNLHEPEEEKISEEVDDEEPMQSQGMEE 77 Query: 380 NVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 511 N EE E +E D+V + E+ E EEE+ Sbjct: 78 NPEEEEKEGEEEEESEEGDDVEPMQSQGMEENPKEEEKEGEEEE 121 >At2g12875.1 68415.m01402 hypothetical protein Length = 325 Score = 35.1 bits (77), Expect = 0.032 Identities = 27/103 (26%), Positives = 49/103 (47%), Gaps = 7/103 (6%) Frame = +2 Query: 191 KKGRGKAKVVEDPETESVEAE---VDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAP 361 K+ RG A + D T++ E ++ + K + K + + +DE K EE Sbjct: 77 KRKRGVATKLIDKGTKATTEEPSSTEQNKAIEAVKEDKYDKNEEEKSEKDEQEKSEEEES 136 Query: 362 KKGRKK----NVEEPPVENXSTDEPSVEDEVAVSEENNPSEDG 478 ++ K+ + EE ++ +T+EPS +E + SE+N E G Sbjct: 137 EEEEKEEGNDDGEESSNDSTTTEEPSSTEEPSSSEQNKAIEGG 179 Score = 32.3 bits (70), Expect = 0.23 Identities = 23/86 (26%), Positives = 36/86 (41%) Frame = +2 Query: 263 KNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEV 442 K V+ K +G KA + E K E + KN EE ++ E S E+E Sbjct: 79 KRGVATKLIDKGTKATTEEPSSTEQNKAIEAVKEDKYDKNEEEKSEKDEQ--EKSEEEES 136 Query: 443 AVSEENNPSEDGSETNGHIEEEQVPS 520 E+ ++DG E++ + PS Sbjct: 137 EEEEKEEGNDDGEESSNDSTTTEEPS 162 Score = 27.5 bits (58), Expect = 6.4 Identities = 24/104 (23%), Positives = 44/104 (42%), Gaps = 7/104 (6%) Frame = +2 Query: 221 EDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDE-----NGKIEETAPKKGRKKNV 385 +D E S ++ E+ +E+ + + A + G +E +E +K K Sbjct: 146 DDGEESSNDSTTTEEPSSTEEPSSSEQNKAIEGGGTEEPILALTPVLEAVEEEKSYKNEE 205 Query: 386 E--EPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 511 E E E S +E S E+E E+ E+G++ G I ++ Sbjct: 206 EKSEKDEEEKSEEEESEEEEKEEEEKEEEKEEGNDCWGRISPKR 249 >At2g04970.1 68415.m00518 hypothetical protein similar to At2g15200, At1g32830, At2g14140, At3g30450, At4g03990, At5g34895, At3g47270, At2g02200 Length = 808 Score = 35.1 bits (77), Expect = 0.032 Identities = 30/112 (26%), Positives = 51/112 (45%), Gaps = 2/112 (1%) Frame = +2 Query: 182 DAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAP 361 + PK+G + + E+ + E + E +EK V + + K G +E EE Sbjct: 459 EIPKQGNEEMEGEEEKQEEEGKEEEEEKICVEYRGDEGTEKQEIPKQGDEEMEGEEEKQE 518 Query: 362 KKGRKKNVEEPPVENXSTDEPSVEDEVAV--SEENNPSEDGSETNGHIEEEQ 511 ++G+++ EE VE DE + + E+ EE E+ E G EEE+ Sbjct: 519 EEGKEE--EEEKVEYRG-DEGTEKQEIPKQGDEEMEGEEEKQEEEGKEEEEE 567 >At1g60640.1 68414.m06826 expressed protein Length = 340 Score = 35.1 bits (77), Expect = 0.032 Identities = 25/109 (22%), Positives = 52/109 (47%), Gaps = 1/109 (0%) Frame = +2 Query: 191 KKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKG 370 KK K+V++ + + + EVD+ S++K K+G + + G+ + +++ K G Sbjct: 138 KKHARMEKLVKEGKIRTDDEEVDDLETASQEKEKKGNRRS-QRQGKRSQKQEKDSLTKNG 196 Query: 371 RKKNVEEPPVENXSTDEPSVEDEVAVSE-ENNPSEDGSETNGHIEEEQV 514 + VE+P E S ++ + A E + ++ + H E E+V Sbjct: 197 ENEEVEDP--ETPSQEKQIKGNRRARRELRRSQKQEKDSSTKHGENEEV 243 Score = 29.5 bits (63), Expect = 1.6 Identities = 17/60 (28%), Positives = 37/60 (61%), Gaps = 2/60 (3%) Frame = +2 Query: 203 GKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQ-DENGKIEET-APKKGRK 376 G+ + VEDPET S E ++ + N + ++ +R +K D++ + EN +++ + P +G++ Sbjct: 196 GENEEVEDPETPSQEKQI-KGNRRARRELRRSQKQEKDSSTKHGENEEVDNSGTPSQGKQ 254 >At5g64030.1 68418.m08039 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 829 Score = 34.3 bits (75), Expect = 0.056 Identities = 29/105 (27%), Positives = 50/105 (47%), Gaps = 9/105 (8%) Frame = +2 Query: 191 KKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKK- 367 KKG G A + ++ E+ S + +EK E+KTK + +T + E G+ ++ K Sbjct: 88 KKGDGDASLPKEDESSSKQDNQEEK---KEEKTKEEFTPSSETKSETEGGEDQKDDSKSE 144 Query: 368 -------GRKKNVEE-PPVENXSTDEPSVEDEVAVSEENNPSEDG 478 KK++++ EN T+E + E +E+N EDG Sbjct: 145 NGGGGDLDEKKDLKDNSDEENPDTNEKQTKPE---TEDNELGEDG 186 >At1g29000.1 68414.m03546 heavy-metal-associated domain-containing protein similar to farnesylated protein ATFP3 [GI:4097547]; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 287 Score = 34.3 bits (75), Expect = 0.056 Identities = 27/95 (28%), Positives = 40/95 (42%), Gaps = 3/95 (3%) Frame = +2 Query: 206 KAKVVEDPETESVEAEVDEKNIVSEKKTKRG---RKAAGDTNGQDENGKIEETAPKKGRK 376 K KV + E S + E ++K +KK K +K + ++E K EE K+G K Sbjct: 168 KKKVHKHAEIISSKTEEEKKKEEEDKKKKEEEDKKKKEDEKKKEEEKKKEEENKKKEGEK 227 Query: 377 KNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGS 481 K E T VE + V E +DG+ Sbjct: 228 KKEEVKVEVTTKTITQVVEYKEIVKVEGQKDKDGN 262 >At1g03320.1 68414.m00311 hypothetical protein Length = 220 Score = 34.3 bits (75), Expect = 0.056 Identities = 27/96 (28%), Positives = 45/96 (46%) Frame = +2 Query: 206 KAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNV 385 + K + +++ E E DE+++ ++K + D+NG E G E K + KNV Sbjct: 10 QVKATKKKKSKKNEDEPDEEDVKQKQKVSKNENPKKDSNG--EKGSDE----KDKKNKNV 63 Query: 386 EEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNG 493 P ++ ST + + + SEEN SE NG Sbjct: 64 LRWP-QDSSTKKEKGDGKNLSSEENGGKNLPSEKNG 98 >At4g05410.1 68417.m00823 transducin family protein / WD-40 repeat family protein contains 6 WD-40 repeats (PF00400); U3 snoRNP-associated 55-kDa protein, Homo sapiens, gb:NP_004695; Vegetatible incompatibility protein HET-E-1 (SP:Q00808) [Podospora anserina] Length = 504 Score = 33.9 bits (74), Expect = 0.074 Identities = 21/78 (26%), Positives = 34/78 (43%) Frame = +2 Query: 275 SEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSE 454 + +K K G G G +E E PKK RK + ++ +E SV+ + + Sbjct: 4 NNEKKKGGSFKRGGKKGSNERDPFFEEEPKKRRKVSYDDDDIE-------SVDSDAEENG 56 Query: 455 ENNPSEDGSETNGHIEEE 508 EDG +G +E+E Sbjct: 57 FTGGDEDGRRVDGEVEDE 74 >At1g17690.1 68414.m02190 expressed protein Length = 754 Score = 33.9 bits (74), Expect = 0.074 Identities = 29/110 (26%), Positives = 47/110 (42%) Frame = +2 Query: 182 DAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAP 361 D K + +V +P T+S E E +I +E + R+ N G + Sbjct: 23 DTKKHKHVEKTIVSNPSTDSPE----ESSIEAESEAMVYREPTQYQNLLVSLGSSNKVVA 78 Query: 362 KKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 511 +++ EE E S E +DE EEN+ S+D S T+G ++ Q Sbjct: 79 DMNKRRQREE---EGKSDTEEDEDDEDEDEEENSGSDDLSSTDGEDDKSQ 125 >At5g57120.1 68418.m07132 expressed protein weak similarity to SP|Q14978 Nucleolar phosphoprotein p130 {Homo sapiens} Length = 330 Score = 33.5 bits (73), Expect = 0.098 Identities = 33/106 (31%), Positives = 48/106 (45%), Gaps = 6/106 (5%) Frame = +2 Query: 212 KVVEDPETESVEAEV---DEKNIVSEKKTKRGRKAAGDTNGQDENGKIE--ETAPKKGRK 376 K++ + E E E D + I SE KR +AA NG E +E E K +K Sbjct: 37 KLLSEAEIEKKELNTSLPDLEEIFSEFLNKRDHEAAA--NGNTEANVVEAVENVKKDKKK 94 Query: 377 KNVEEPPVENXSTDEPSVEDEVAVSEEN-NPSEDGSETNGHIEEEQ 511 K +E VE T+E V++ AV E+ + ET + EE+ Sbjct: 95 KKNKETKVE--VTEEEKVKETDAVIEDGVKEKKKKKETKVKVTEEE 138 Score = 31.1 bits (67), Expect = 0.52 Identities = 24/107 (22%), Positives = 44/107 (41%) Frame = +2 Query: 191 KKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKG 370 KK K KV E+ + + +A +++ V EKK K+ + + + + E K Sbjct: 126 KKKETKVKVTEEEKVKETDAVIEDG--VKEKKKKKSKSKSVEADDDKE---------KVS 174 Query: 371 RKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 511 +K+ EP T++ E + EEN D ++E + Sbjct: 175 KKRKRSEPEETKEETEDDDEESKRRKKEENVVENDEGVQETPVKETE 221 >At4g26630.1 68417.m03837 expressed protein Length = 763 Score = 33.5 bits (73), Expect = 0.098 Identities = 29/112 (25%), Positives = 49/112 (43%), Gaps = 7/112 (6%) Frame = +2 Query: 206 KAKVVEDPETESVEAE---VDE-KNIVSEKKTKRG--RKAAGDTNGQDENGKIE-ETAPK 364 KA +D T ++ E VDE K ++K + G K + G+++ K E +T Sbjct: 169 KANGTKDGNTGDIKEEGTLVDEDKGTDMDEKVENGDENKQVENVEGKEKEDKEENKTKEV 228 Query: 365 KGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVPS 520 + K V+E VE+ D V ++ ++ ETN E+E+ S Sbjct: 229 EAAKAEVDESKVEDEKEGSEDENDNEKVESKDAKEDEKEETNDDKEDEKEES 280 Score = 27.5 bits (58), Expect = 6.4 Identities = 24/104 (23%), Positives = 40/104 (38%), Gaps = 1/104 (0%) Frame = +2 Query: 185 APKKGRGKAKVVEDPETESVEA-EVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAP 361 +P G +K + +S EA +V +K++ K + + E K EE Sbjct: 487 SPTAGSSSSKRSAKSQKKSEEATKVVKKSLAHSDDESEEEK---EEEEKQEEEKAEEKEE 543 Query: 362 KKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNG 493 KK + P +PS +E SEE++ E + G Sbjct: 544 KKEEENENGIPDKSEDEAPQPSESEEKDESEEHSEEETTKKKRG 587 >At4g08710.1 68417.m01439 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 715 Score = 33.5 bits (73), Expect = 0.098 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +2 Query: 347 EETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 511 +ETAP + + ++ E EN +E E++ +E E+G E EEE+ Sbjct: 62 KETAPTRTEEPSLTEQDPENVEEEESEEEEKEEEEKEEEEEEEGEEEEEEEEEEE 116 Score = 32.3 bits (70), Expect = 0.23 Identities = 27/109 (24%), Positives = 43/109 (39%), Gaps = 2/109 (1%) Frame = +2 Query: 191 KKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAP--K 364 K+ RG V+ E+ A ++ + K+T K T + E +ETAP K Sbjct: 6 KRKRGVGTTVKSTTEETATAT--KETAPATKETAPATKETAPTITK-ETAPTKETAPATK 62 Query: 365 KGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 511 + EEP + + E+ +E E+ E G EEE+ Sbjct: 63 ETAPTRTEEPSLTEQDPENVEEEESEEEEKEEEEKEEEEEEEGEEEEEE 111 Score = 27.5 bits (58), Expect = 6.4 Identities = 25/99 (25%), Positives = 38/99 (38%) Frame = +2 Query: 227 PETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVEN 406 P T+ E K+T ++ A T + + EE + + +NVEE E Sbjct: 31 PATKETAPATKETAPTITKETAPTKETAPATK-ETAPTRTEEPSLTEQDPENVEEEESEE 89 Query: 407 XSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVPSG 523 +E E+E EE E+ E EEE+ G Sbjct: 90 EEKEEEEKEEE--EEEEGEEEEEEEEEEEEKEEEENVGG 126 Score = 27.5 bits (58), Expect = 6.4 Identities = 24/90 (26%), Positives = 38/90 (42%), Gaps = 2/90 (2%) Frame = +2 Query: 221 EDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQD-ENGKIEETAPK-KGRKKNVEEP 394 E T + E ++ + K+T R QD EN + EE+ + K ++ EE Sbjct: 42 ETAPTITKETAPTKETAPATKETAPTRTEEPSLTEQDPENVEEEESEEEEKEEEEKEEEE 101 Query: 395 PVENXSTDEPSVEDEVAVSEENNPSEDGSE 484 E +E E+E EEN E+ S+ Sbjct: 102 EEEGEEEEEEEEEEEEKEEEENVGGEESSD 131 >At3g30450.1 68416.m03852 hypothetical protein similar to At2g04970, At2g15200, At1g32830, At2g14140, At4g03990, At5g34895, At3g47270, At2g02200 Length = 800 Score = 33.5 bits (73), Expect = 0.098 Identities = 29/113 (25%), Positives = 52/113 (46%), Gaps = 7/113 (6%) Frame = +2 Query: 200 RGKAKVVEDPETESVEAEVDEKNIVS---EKKTKR-GRKAAGDTNGQDENGKIEETAPKK 367 +G+ V P E+V + ++ +S +++TKR GRK + Q+E GK EE + Sbjct: 344 QGRIDHVLKPAIETVVHQSRKRKSMSFGEKRRTKRRGRKKEQEEEKQEEEGKEEELEKVE 403 Query: 368 GR-KKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGH--IEEEQVP 517 R + E+ + +E E+E E E+ E G E++++P Sbjct: 404 YRGDEGTEKQEIPKQGDEEMEGEEEKQEEEGKEEEEEKVEYRGDEGTEKQEIP 456 >At2g18540.1 68415.m02160 cupin family protein contains Pfam profile PF00190: Cupin Length = 707 Score = 33.1 bits (72), Expect = 0.13 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 4/96 (4%) Frame = +2 Query: 236 ESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKG---RKKNVEEPPVEN 406 E+ E +E E++T+R ++ + ++E K EE K+ RKK EE Sbjct: 458 EAKRREEEEAKRREEEETERKKREEEEARKREEERKREEEEAKRREEERKKREEEAEQAR 517 Query: 407 XSTDEPSVEDEVAVS-EENNPSEDGSETNGHIEEEQ 511 +E E+E+A EE ++ E EEQ Sbjct: 518 KREEEREKEEEMAKKREEERQRKEREEVERKRREEQ 553 >At5g55660.1 68418.m06940 expressed protein similar to unknown protein (pir||T08929) Length = 778 Score = 32.7 bits (71), Expect = 0.17 Identities = 27/104 (25%), Positives = 52/104 (50%), Gaps = 6/104 (5%) Frame = +2 Query: 191 KKGRG-KAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDT--NGQDENGKIEETAP 361 +K +G K K + + + +++ S+KKT+ + + + DE+ + +E Sbjct: 478 EKEKGVKRKRTPKKSSPAAGSSSSKRSAKSQKKTEEATRTNKKSVAHSDDESEEEKEDDE 537 Query: 362 KKGRKKNVEEPPVENXSTDEPSVEDE---VAVSEENNPSEDGSE 484 ++ +++ VEE EN + EDE ++ SEEN SE+ SE Sbjct: 538 EEEKEQEVEEEEEENENGIPDKSEDEAPQLSESEENVESEEESE 581 Score = 31.1 bits (67), Expect = 0.52 Identities = 26/110 (23%), Positives = 51/110 (46%), Gaps = 8/110 (7%) Frame = +2 Query: 206 KAKVVEDPETESVEAEVDEKNIVSEKKTKRGR--KAAGDTNGQDENGKIEE--TAPKKGR 373 K + V++ + E E +E + E++T +G K A + + + K+ E KK Sbjct: 182 KVENVDEDDKEEALKEKNEAELAEEEETNKGEEVKEANKEDDVEADTKVAEPEVEDKKTE 241 Query: 374 KKNVEEPPVENXSTD-EPSV---EDEVAVSEENNPSEDGSETNGHIEEEQ 511 K+ E E + E S+ EDE S +++ ++ E+N E+++ Sbjct: 242 SKDENEDKEEEKEDEKEESMDDKEDEKEESNDDDKEDEKEESNDDKEDKK 291 Score = 28.7 bits (61), Expect = 2.8 Identities = 31/113 (27%), Positives = 48/113 (42%) Frame = +2 Query: 176 DNDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEET 355 + D +K G K + E E VE VDE +K+ K + ++E K EE Sbjct: 161 EGDTEEKLVGGDKGDDVDEAEKVE-NVDE----DDKEEALKEKNEAELAEEEETNKGEEV 215 Query: 356 APKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQV 514 ++ N E+ + EP VED+ S++ N ED E +EE + Sbjct: 216 -----KEANKEDDVEADTKVAEPEVEDKKTESKDEN--EDKEEEKEDEKEESM 261 >At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nicotiana tabacum, EMBL:AB009883 Length = 1008 Score = 32.7 bits (71), Expect = 0.17 Identities = 29/110 (26%), Positives = 48/110 (43%) Frame = +2 Query: 191 KKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKG 370 K+ + ++K E E E + E +E K+ K K D G++E K + KK Sbjct: 733 KRKKSESKK-EGGEGEETQKEANESTKKERKRKKSESKKQSD--GEEETQKEPSESTKKE 789 Query: 371 RKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVPS 520 RK+ E + + +E E S E+ E + H +EE+VP+ Sbjct: 790 RKRKNPESKKKAEAVEEEETRKE---SVESTKKERKRKKPKH-DEEEVPN 835 Score = 32.3 bits (70), Expect = 0.23 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 6/87 (6%) Frame = +2 Query: 278 EKKTKRGR---KAAG-DTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVA 445 EKK K+G+ KA + G++EN + KK RK+ E E +E E + Sbjct: 697 EKKDKKGKAKQKAEEIEVTGKEENETDKHGKMKKERKRKKSESKKEGGEGEETQKEANES 756 Query: 446 VSEE--NNPSEDGSETNGHIEEEQVPS 520 +E SE +++G E ++ PS Sbjct: 757 TKKERKRKKSESKKQSDGEEETQKEPS 783 Score = 32.3 bits (70), Expect = 0.23 Identities = 30/113 (26%), Positives = 46/113 (40%), Gaps = 6/113 (5%) Frame = +2 Query: 191 KKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEET----- 355 KKG+ K K E T E E D+ + K +R RK + + E G+ EET Sbjct: 701 KKGKAKQKAEEIEVTGKEENETDKHG---KMKKERKRKKS---ESKKEGGEGEETQKEAN 754 Query: 356 -APKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 511 + KK RK+ E ++ +E E + +E S+ EE+ Sbjct: 755 ESTKKERKRKKSESKKQSDGEEETQKEPSESTKKERKRKNPESKKKAEAVEEE 807 Score = 27.5 bits (58), Expect = 6.4 Identities = 21/85 (24%), Positives = 36/85 (42%) Frame = +2 Query: 179 NDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETA 358 +++ KK R + + E+VE E K V + TK+ RK + ++E E Sbjct: 783 SESTKKERKRKNPESKKKAEAVEEEETRKESV--ESTKKERKRKKPKHDEEEVPNETEKP 840 Query: 359 PKKGRKKNVEEPPVENXSTDEPSVE 433 KK +KK + + T+ E Sbjct: 841 EKKKKKKREGKSKKKETETEFSGAE 865 >At4g34430.4 68417.m04893 DNA-binding family protein contains Pfam domains PF04433: SWIRM domain, PF00249: Myb-like DNA-binding domain and PF00569: Zinc finger, ZZ type Length = 986 Score = 32.7 bits (71), Expect = 0.17 Identities = 18/62 (29%), Positives = 30/62 (48%) Frame = +2 Query: 326 QDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEE 505 +D+N +++ + KK V+E EP +E VS+E++ D SE +E Sbjct: 435 KDDNSVLKDAPEEAENKKRVDEDETMK-EVPEPEDGNEEKVSQESSKPGDASEETNEMEA 493 Query: 506 EQ 511 EQ Sbjct: 494 EQ 495 Score = 28.3 bits (60), Expect = 3.7 Identities = 18/61 (29%), Positives = 31/61 (50%) Frame = +2 Query: 182 DAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAP 361 DAP++ K +V ED E+++ EV E +E+K + GD + + + E+ P Sbjct: 443 DAPEEAENKKRVDED---ETMK-EVPEPEDGNEEKVSQESSKPGDASEETNEMEAEQKTP 498 Query: 362 K 364 K Sbjct: 499 K 499 >At4g34430.3 68417.m04892 DNA-binding family protein contains Pfam domains PF04433: SWIRM domain, PF00249: Myb-like DNA-binding domain and PF00569: Zinc finger, ZZ type Length = 983 Score = 32.7 bits (71), Expect = 0.17 Identities = 18/62 (29%), Positives = 30/62 (48%) Frame = +2 Query: 326 QDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEE 505 +D+N +++ + KK V+E EP +E VS+E++ D SE +E Sbjct: 435 KDDNSVLKDAPEEAENKKRVDEDETMK-EVPEPEDGNEEKVSQESSKPGDASEETNEMEA 493 Query: 506 EQ 511 EQ Sbjct: 494 EQ 495 Score = 28.3 bits (60), Expect = 3.7 Identities = 18/61 (29%), Positives = 31/61 (50%) Frame = +2 Query: 182 DAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAP 361 DAP++ K +V ED E+++ EV E +E+K + GD + + + E+ P Sbjct: 443 DAPEEAENKKRVDED---ETMK-EVPEPEDGNEEKVSQESSKPGDASEETNEMEAEQKTP 498 Query: 362 K 364 K Sbjct: 499 K 499 >At4g34430.2 68417.m04891 DNA-binding family protein contains Pfam domains PF04433: SWIRM domain, PF00249: Myb-like DNA-binding domain and PF00569: Zinc finger, ZZ type Length = 985 Score = 32.7 bits (71), Expect = 0.17 Identities = 18/62 (29%), Positives = 30/62 (48%) Frame = +2 Query: 326 QDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEE 505 +D+N +++ + KK V+E EP +E VS+E++ D SE +E Sbjct: 435 KDDNSVLKDAPEEAENKKRVDEDETMK-EVPEPEDGNEEKVSQESSKPGDASEETNEMEA 493 Query: 506 EQ 511 EQ Sbjct: 494 EQ 495 Score = 28.3 bits (60), Expect = 3.7 Identities = 18/61 (29%), Positives = 31/61 (50%) Frame = +2 Query: 182 DAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAP 361 DAP++ K +V ED E+++ EV E +E+K + GD + + + E+ P Sbjct: 443 DAPEEAENKKRVDED---ETMK-EVPEPEDGNEEKVSQESSKPGDASEETNEMEAEQKTP 498 Query: 362 K 364 K Sbjct: 499 K 499 >At4g34430.1 68417.m04890 DNA-binding family protein contains Pfam domains PF04433: SWIRM domain, PF00249: Myb-like DNA-binding domain and PF00569: Zinc finger, ZZ type Length = 985 Score = 32.7 bits (71), Expect = 0.17 Identities = 18/62 (29%), Positives = 30/62 (48%) Frame = +2 Query: 326 QDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEE 505 +D+N +++ + KK V+E EP +E VS+E++ D SE +E Sbjct: 435 KDDNSVLKDAPEEAENKKRVDEDETMK-EVPEPEDGNEEKVSQESSKPGDASEETNEMEA 493 Query: 506 EQ 511 EQ Sbjct: 494 EQ 495 Score = 28.3 bits (60), Expect = 3.7 Identities = 18/61 (29%), Positives = 31/61 (50%) Frame = +2 Query: 182 DAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAP 361 DAP++ K +V ED E+++ EV E +E+K + GD + + + E+ P Sbjct: 443 DAPEEAENKKRVDED---ETMK-EVPEPEDGNEEKVSQESSKPGDASEETNEMEAEQKTP 498 Query: 362 K 364 K Sbjct: 499 K 499 >At3g42580.1 68416.m04420 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 903 Score = 32.7 bits (71), Expect = 0.17 Identities = 29/97 (29%), Positives = 46/97 (47%), Gaps = 5/97 (5%) Frame = +2 Query: 245 EAEVDEKNIVSEK-KTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDE 421 E K I+S+ T + A D G E + PK ++N EPP + +E Sbjct: 489 EGLAQSKPIMSDDVPTSTHQDVAKDVVGNTEESVVAAELPKM--EENSMEPP--HSPQNE 544 Query: 422 PSVEDE--VAVSEENNPSEDGSETNGH--IEEEQVPS 520 P V DE VA +E+N +++ + +G ++E Q PS Sbjct: 545 PRVRDEIDVAHTEDNKRNDEPTSGDGEEVLKEAQSPS 581 >At1g71470.1 68414.m08259 hypothetical protein Length = 131 Score = 32.7 bits (71), Expect = 0.17 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = +2 Query: 359 PK-KGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEE 505 PK + ++ + + V N S D+ S+EDE + SE NN +E NG +E Sbjct: 10 PKPESSEEELSDSQVSNSSEDDDSMEDEPSDSENNNGVVTETEANGIKDE 59 >At5g41020.1 68418.m04986 myb family transcription factor contains Pfam profile: PF00249 Myb DNA binding domain Length = 588 Score = 32.3 bits (70), Expect = 0.23 Identities = 21/80 (26%), Positives = 41/80 (51%), Gaps = 2/80 (2%) Frame = +2 Query: 239 SVEAEVDEKNIVS--EKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXS 412 SV+++V++ N+ S + K KR +K + + +ENG KK RKK ++ E Sbjct: 194 SVDSDVEDINLDSTNDGKKKRKKKKQSEDSETEENGLNSTKDAKKRRKKKKKKKQSEVSE 253 Query: 413 TDEPSVEDEVAVSEENNPSE 472 +E S + + ++ + S+ Sbjct: 254 AEEKSDKSDEDLTTPSTSSK 273 Score = 29.9 bits (64), Expect = 1.2 Identities = 30/106 (28%), Positives = 49/106 (46%), Gaps = 1/106 (0%) Frame = +2 Query: 179 NDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETA 358 +D K+ + K+K E+ E E + VS+KK +G++ DT+ E +E Sbjct: 132 HDGVKRKKKKSK----KESGGDVIENTESSKVSDKK--KGKRKRDDTDLGAEENIDKEVK 185 Query: 359 PKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDG-SETNG 493 K +KK + VE+ + D S D ++ SED +E NG Sbjct: 186 RKNNKKKPSVDSDVEDINLD--STNDGKKKRKKKKQSEDSETEENG 229 >At4g33740.2 68417.m04791 expressed protein Length = 227 Score = 32.3 bits (70), Expect = 0.23 Identities = 32/114 (28%), Positives = 53/114 (46%), Gaps = 13/114 (11%) Frame = +2 Query: 206 KAKVVEDPETESVEAEVDEKNI----VSEKKTKRGRKAAGDTN-GQDENGK-IEETAPKK 367 + K D + E E +V++ + V + K GRK N Q EN K +EE ++ Sbjct: 36 QVKYSHDKKKEFYEKDVEKSTVLLSEVEDGVVKLGRKDLLPKNYNQKENEKHVEEDEDEE 95 Query: 368 ----GRKKNVEEPPVENXSTDEP---SVEDEVAVSEENNPSEDGSETNGHIEEE 508 G ++ ++ VEN + +E E+EVA +E + ++ G E EEE Sbjct: 96 EISHGGEEKEKKSKVENGNHEEEVEKDEEEEVAEDDEEDKNKQGEEVAEEDEEE 149 Score = 27.5 bits (58), Expect = 6.4 Identities = 22/96 (22%), Positives = 42/96 (43%), Gaps = 3/96 (3%) Frame = +2 Query: 230 ETESVEAEVDEKNIVSEK-KTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVE-EPPVE 403 E E ++ K+++ + K K + ++E E KK + +N E VE Sbjct: 61 EVEDGVVKLGRKDLLPKNYNQKENEKHVEEDEDEEEISHGGEEKEKKSKVENGNHEEEVE 120 Query: 404 NXSTDEPSVEDEVAVSEENNP-SEDGSETNGHIEEE 508 +E + +DE +++ +E+ E N H E+E Sbjct: 121 KDEEEEVAEDDEEDKNKQGEEVAEEDEEENKHEEDE 156 >At4g33740.1 68417.m04790 expressed protein Length = 227 Score = 32.3 bits (70), Expect = 0.23 Identities = 32/114 (28%), Positives = 53/114 (46%), Gaps = 13/114 (11%) Frame = +2 Query: 206 KAKVVEDPETESVEAEVDEKNI----VSEKKTKRGRKAAGDTN-GQDENGK-IEETAPKK 367 + K D + E E +V++ + V + K GRK N Q EN K +EE ++ Sbjct: 36 QVKYSHDKKKEFYEKDVEKSTVLLSEVEDGVVKLGRKDLLPKNYNQKENEKHVEEDEDEE 95 Query: 368 ----GRKKNVEEPPVENXSTDEP---SVEDEVAVSEENNPSEDGSETNGHIEEE 508 G ++ ++ VEN + +E E+EVA +E + ++ G E EEE Sbjct: 96 EISHGGEEKEKKSKVENGNHEEEVEKDEEEEVAEDDEEDKNKQGEEVAEEDEEE 149 Score = 27.5 bits (58), Expect = 6.4 Identities = 22/96 (22%), Positives = 42/96 (43%), Gaps = 3/96 (3%) Frame = +2 Query: 230 ETESVEAEVDEKNIVSEK-KTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVE-EPPVE 403 E E ++ K+++ + K K + ++E E KK + +N E VE Sbjct: 61 EVEDGVVKLGRKDLLPKNYNQKENEKHVEEDEDEEEISHGGEEKEKKSKVENGNHEEEVE 120 Query: 404 NXSTDEPSVEDEVAVSEENNP-SEDGSETNGHIEEE 508 +E + +DE +++ +E+ E N H E+E Sbjct: 121 KDEEEEVAEDDEEDKNKQGEEVAEEDEEENKHEEDE 156 >At4g22320.1 68417.m03227 expressed protein Length = 238 Score = 32.3 bits (70), Expect = 0.23 Identities = 21/82 (25%), Positives = 41/82 (50%), Gaps = 1/82 (1%) Frame = +2 Query: 215 VVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEP 394 V+E+ + E E E D+K I + K K + DE+ +EE++ KK + E+P Sbjct: 121 VLEEQKKEITEIEEDDK-IEEDDKIDEDNKVEQEDK-VDEDKTVEESSEKKAEVEVEEKP 178 Query: 395 PVENXSTDE-PSVEDEVAVSEE 457 + + ++ VE+++ +E Sbjct: 179 DINDVPMEDIQQVEEKIVQDDE 200 >At3g57060.1 68416.m06353 non-SMC condensin subunit, XCAP-D2/Cnd1 family protein similar to 13S condensin XCAP-D2 subunit [Xenopus laevis] GI:3764087; contains Pfam profile PF04594: Non-SMC condensin subunit, XCAP-D2/Cnd1 Length = 1439 Score = 32.3 bits (70), Expect = 0.23 Identities = 23/104 (22%), Positives = 44/104 (42%), Gaps = 1/104 (0%) Frame = +2 Query: 191 KKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKG 370 +K G + +PE E ++E D + RK +GD + E+ + E++ ++ Sbjct: 1327 QKTSGDNLIETEPEEEQSDSEPDSAQCGTTNPRSLNRKTSGDNLIETESEE-EQSDSEEE 1385 Query: 371 RKKNVEEPPVENXSTDEP-SVEDEVAVSEENNPSEDGSETNGHI 499 + EEP T P S+ + + EE +E++ I Sbjct: 1386 PSDSEEEPDSAQCGTTNPRSLNQKTSGGEEGESESKSTESSSSI 1429 >At5g63550.1 68418.m07976 expressed protein Length = 530 Score = 31.9 bits (69), Expect = 0.30 Identities = 26/111 (23%), Positives = 45/111 (40%), Gaps = 5/111 (4%) Frame = +2 Query: 176 DNDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEET 355 D+ AP++ K D E + VE E K S KKT + + + G+D+ + + Sbjct: 309 DDAAPEEESDHEKTDTDDEKDEVEVEKPSKKKSSSKKTV---EESSGSKGKDKQPSAKGS 365 Query: 356 APKKGRKKNVE-----EPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNG 493 A + G K + + P + D E + + + P GS+ G Sbjct: 366 A-RSGEKSSKQIAKSTSSPAKKQKVDHVESSKEKSKKQPSKPQAKGSKEKG 415 Score = 28.3 bits (60), Expect = 3.7 Identities = 24/87 (27%), Positives = 33/87 (37%), Gaps = 4/87 (4%) Frame = +2 Query: 275 SEKKTKRGRKAAG-DTNGQDENGKIEETAPKKGRKKNVEEP---PVENXSTDEPSVEDEV 442 S+ KR R+ D E GK E A +G EE P E ++ +DE Sbjct: 269 SDTPAKRKRQTKKRDLPSDTEEGKDEGDADSEGTNDPHEEDDAAPEEESDHEKTDTDDEK 328 Query: 443 AVSEENNPSEDGSETNGHIEEEQVPSG 523 E PS+ S + +EE G Sbjct: 329 DEVEVEKPSKKKSSSKKTVEESSGSKG 355 >At5g17980.1 68418.m02109 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1049 Score = 31.9 bits (69), Expect = 0.30 Identities = 25/96 (26%), Positives = 37/96 (38%), Gaps = 8/96 (8%) Frame = +2 Query: 194 KGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGR 373 K G + PET + AEV E + + A G ++ + ++E A G Sbjct: 161 KAEGPDESKPPPETNDIPAEVKETVKPPQPPPEESSPAEGPKPDEEASPPLQENATVGGE 220 Query: 374 --------KKNVEEPPVENXSTDEPSVEDEVAVSEE 457 K E PVE ++P ED V SE+ Sbjct: 221 EPPASESDKNEAEAKPVEEPPQNQPDGEDIVLESED 256 Score = 28.3 bits (60), Expect = 3.7 Identities = 24/96 (25%), Positives = 38/96 (39%) Frame = +2 Query: 179 NDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETA 358 ND P + + K + P ES AE + + + + G+ E+ K E A Sbjct: 175 NDIPAEVKETVKPPQPPPEESSPAEGPKPDEEASPPLQENATVGGEEPPASESDKNEAEA 234 Query: 359 PKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNP 466 K VEEPP ++ +E E +S + P Sbjct: 235 ------KPVEEPPQNQPDGEDIVLESEDTMSWASAP 264 >At3g44750.1 68416.m04817 histone deacetylase, putative (HD2A) contains Pfam domain, PF00096: Zinc finger, C2H2 type; identical to cDNA putative histone deacetylase (HD2A) GI:11066134 Length = 245 Score = 31.9 bits (69), Expect = 0.30 Identities = 19/63 (30%), Positives = 29/63 (46%) Frame = +2 Query: 329 DENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEE 508 +E + EE P K V +P + +P+V+DE S+ + ED S+ EEE Sbjct: 104 EEEEEEEEEVPAGNAAKAVAKPKAKPAEV-KPAVDDEEDESDSDGMDEDDSDGEDSEEEE 162 Query: 509 QVP 517 P Sbjct: 163 PTP 165 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 31.9 bits (69), Expect = 0.30 Identities = 30/116 (25%), Positives = 50/116 (43%), Gaps = 5/116 (4%) Frame = +2 Query: 176 DNDAPKKGRGKA-KVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEE 352 DN K+ A K E E E +++ E+ +KK++ ++ D+ + + EE Sbjct: 995 DNKEKKESEDSASKNREKKEYEEKKSKTKEEAKKEKKKSQDKKREEKDSEERKSKKEKEE 1054 Query: 353 TAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPS----EDGSETNGHIEEE 508 + K +KK EE + S + S + E E+N S ED E H E + Sbjct: 1055 SRDLKAKKKE-EETKEKKESENHKSKKKEDKKEHEDNKSMKKEEDKKEKKKHEESK 1109 Score = 31.1 bits (67), Expect = 0.52 Identities = 27/103 (26%), Positives = 49/103 (47%), Gaps = 6/103 (5%) Frame = +2 Query: 221 EDPETESVEAEVDEKNIVSEKKTK----RGRKAAGDTNG-QDENGKIEETAPKKGR-KKN 382 E + +SVEA+ +K KKTK R R + G + E+ K+E+ K+ + K+ Sbjct: 739 ESKDDKSVEAKGKKKESKENKKTKTNENRVRNKEENVQGNKKESEKVEKGEKKESKDAKS 798 Query: 383 VEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 511 VE + S+ E E + E+N ++ S+ +E ++ Sbjct: 799 VETKDNKKLSSTENRDEAKERSGEDNKEDKEESKDYQSVEAKE 841 Score = 30.7 bits (66), Expect = 0.69 Identities = 21/103 (20%), Positives = 44/103 (42%) Frame = +2 Query: 206 KAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNV 385 K K + + E E+ E EKK K+ + +EN K +ET +K + K+ Sbjct: 1181 KEKKSSKDQQKKKEKEMKESE---EKKLKKNEEDRKKQTSVEENKKQKETKKEKNKPKDD 1237 Query: 386 EEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQV 514 ++ + + S+E E +E S+ ++ + + ++ Sbjct: 1238 KKNTTKQSGGKKESMESESKEAENQQKSQATTQADSDESKNEI 1280 Score = 30.3 bits (65), Expect = 0.91 Identities = 23/102 (22%), Positives = 43/102 (42%), Gaps = 1/102 (0%) Frame = +2 Query: 218 VEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPP 397 V+ ESV+ + DEK ++++ K + G+D+ K +E+ +KK ++ Sbjct: 906 VQKGSGESVKYKKDEKKEGNKEENKDTINTSSKQKGKDKKKKKKESKNSNMKKKEEDKKE 965 Query: 398 -VENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVPS 520 V N + + E SE + E+ + E E S Sbjct: 966 YVNNELKKQEDNKKETTKSENSKLKEENKDNKEKKESEDSAS 1007 Score = 29.5 bits (63), Expect = 1.6 Identities = 18/85 (21%), Positives = 37/85 (43%) Frame = +2 Query: 230 ETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENX 409 + ESV A+ + + + EK+ + + N + + K K ++ +V + +N Sbjct: 613 DDESVGAKTNNETSLEEKREQTQKGHDNSINSKIVDNKGGNADSNKEKEVHVGDSTNDNN 672 Query: 410 STDEPSVEDEVAVSEENNPSEDGSE 484 + + EV V + + SE G E Sbjct: 673 MESKEDTKSEVEVKKNDGSSEKGEE 697 >At5g27160.1 68418.m03241 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 702 Score = 31.5 bits (68), Expect = 0.39 Identities = 28/102 (27%), Positives = 42/102 (41%) Frame = +2 Query: 203 GKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKN 382 G+ ++V +ES + V I+ E R AA + +DEN E+ P+ N Sbjct: 2 GRVRLVTPSSSESEDRRV---TIIREADMNREEVAAEENKFEDEN--CEQEPPE-----N 51 Query: 383 VEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEE 508 + EP E S + E + E NP E+ E EE Sbjct: 52 LNEPEEEKISEEIDDDEPMSSHGMEENPQEEEKEREEENPEE 93 >At5g02390.1 68418.m00162 expressed protein ; expression supported by MPSS Length = 835 Score = 31.5 bits (68), Expect = 0.39 Identities = 28/95 (29%), Positives = 46/95 (48%) Frame = +2 Query: 206 KAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNV 385 K K +PE +S + +E++ + + KR KA IE+ + KKGR Sbjct: 106 KTKKKHNPEEKSKKLNSEERSRKTHSEIKRSVKALIKAL------VIEDKSKKKGRHHRS 159 Query: 386 EEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETN 490 PV++ S ++ S+ EV S++N S +G E N Sbjct: 160 CTYPVQSNSKEKDSL-SEVGSSDKN--SSNGDERN 191 >At4g02400.1 68417.m00324 U3 ribonucleoprotein (Utp) family protein contains Pfam profile: PF04615 Utp14 protein Length = 858 Score = 31.5 bits (68), Expect = 0.39 Identities = 25/86 (29%), Positives = 38/86 (44%), Gaps = 3/86 (3%) Frame = +2 Query: 263 KNIVSEKKTKRGRKAAGDTNGQDENGKI---EETAPKKGRKKNVEEPPVENXSTDEPSVE 433 K I +EK+ + + + DEN + EE P++ KKN V+N + P E Sbjct: 29 KTIANEKRPLNSDEDDDEIDSDDENVDLYEYEEGVPEEESKKNNRYDRVDNYDYELP--E 86 Query: 434 DEVAVSEENNPSEDGSETNGHIEEEQ 511 D E+ N D E G+ E E+ Sbjct: 87 D----FEDENVESDDDEDGGNSENEE 108 >At2g30690.1 68415.m03742 expressed protein contains Pfam profile PF04576: Protein of unknown function, DUF593; expression supported by MPSS Length = 788 Score = 31.5 bits (68), Expect = 0.39 Identities = 26/91 (28%), Positives = 42/91 (46%) Frame = +2 Query: 230 ETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENX 409 E E EA +++K S+ G A + DE ++E + K N+ + + Sbjct: 424 EIEEFEAAIEQKE--SDHMDVSGSVA--NEPSSDEENEVEGDS-KPLISNNMSDSLEQEQ 478 Query: 410 STDEPSVEDEVAVSEENNPSEDGSETNGHIE 502 S +E S +E V+EE +E+ E NGH E Sbjct: 479 SGEEESEVNENNVAEEYFSNEEEDEVNGHTE 509 >At1g67120.1 68414.m07636 midasin-related similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q12019) [Saccharomyces cerevisiae]; similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q9NU22) [Homo sapiens]; contains Prosite PS00017: ATP/GTP-binding site motif A (P-loop) Length = 5336 Score = 31.5 bits (68), Expect = 0.39 Identities = 31/104 (29%), Positives = 42/104 (40%), Gaps = 3/104 (2%) Frame = +2 Query: 203 GKAKVVE-DPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKK 379 GK K +E E + E V E E K G + NG + G E A +K K Sbjct: 4531 GKNKGIEMSDEFDGKEYSVSEDE--EEDKEDEGSEDEPLDNGIGDVGSDAEKADEKPWNK 4588 Query: 380 NVEEPPVENXSTDE--PSVEDEVAVSEENNPSEDGSETNGHIEE 505 + E+ +E PS+ D+ S E +DG ET EE Sbjct: 4589 DEEDEEENMNEKNESGPSIVDKDTRSRELRAKDDGVETADEPEE 4632 Score = 28.3 bits (60), Expect = 3.7 Identities = 27/108 (25%), Positives = 41/108 (37%), Gaps = 3/108 (2%) Frame = +2 Query: 191 KKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKG 370 K R + +D E+ + E +E N + K + G + + D+ +EE K Sbjct: 4610 KDTRSRELRAKDDGVETAD-EPEESN--TSDKPEEGNDENVEQDDFDDTDNLEEKIQTKE 4666 Query: 371 RKKNVEEPPVENXSTD---EPSVEDEVAVSEENNPSEDGSETNGHIEE 505 P V+N D E +EV + N E SE H EE Sbjct: 4667 EALGGLTPDVDNEQIDDDMEMDKTEEVEKEDANQQEEPCSEDQKHPEE 4714 Score = 27.1 bits (57), Expect = 8.5 Identities = 26/118 (22%), Positives = 50/118 (42%), Gaps = 8/118 (6%) Frame = +2 Query: 179 NDAPKKGRGKAKVVED-PETESVEAEVDEKNIVSEKKTKR-GRKAAGDTNGQDENGKIE- 349 +D P++G + +D +T+++E ++ K T + D D+ ++E Sbjct: 4636 SDKPEEGNDENVEQDDFDDTDNLEEKIQTKEEALGGLTPDVDNEQIDDDMEMDKTEEVEK 4695 Query: 350 -----ETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEE 508 + P +K+ EE + T EPS E+ A +E+ S E +E+E Sbjct: 4696 EDANQQEEPCSEDQKHPEEGENDQEETQEPSEENMEAEAEDRCGSPQKEEPGNDLEQE 4753 >At1g08520.1 68414.m00943 magnesium-chelatase subunit chlD, chloroplast, putative / Mg-protoporphyrin IX chelatase, putative (CHLD) similar to Mg-chelatase SP|O24133 from Nicotiana tabacum, GB:AF014399 GI:2318116 from [Pisum sativum] Length = 760 Score = 31.5 bits (68), Expect = 0.39 Identities = 15/58 (25%), Positives = 27/58 (46%) Frame = +2 Query: 344 IEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVP 517 ++ET P++ + PP +N + E E+E EE E E +++Q+P Sbjct: 400 LDETPPEQQNQPPPPPPPPQNSESGEEENEEE---QEEEEEDESNEENENEQQQDQIP 454 >At5g61610.1 68418.m07731 glycine-rich protein / oleosin similar to variable surface lipoprotein Vsp422-3 (GI:15384285) [Mycoplasma bovis]; similar to glycine-rich protein atGRP-6, Arabidopsis thaliana, PIR:T49893 Length = 225 Score = 31.1 bits (67), Expect = 0.52 Identities = 34/118 (28%), Positives = 53/118 (44%), Gaps = 4/118 (3%) Frame = +2 Query: 182 DAPKK--GRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTN-GQDENGKIEE 352 D P K GK ++P E E D K +K +K GD +D+ EE Sbjct: 100 DGPNKLAESGKQSGGDNPLKEDKPPERD-KLPRKDKPSKEDNLLKGDKPVEEDKLPAEEE 158 Query: 353 TAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSED-GSETNGHIEEEQVPSG 523 P+K + +PP D+P+ E + V E+ P +D +E + H+EE+ +P G Sbjct: 159 KPPQKDKPAEGHKPP----QKDKPA-EGDKPVEEDKPPQKDKPAEGDKHVEED-MPLG 210 >At5g61150.1 68418.m07671 leo1-like family protein weak similarity to SP|P38439 LEO1 protein {Saccharomyces cerevisiae}; contains Pfam profile PF04004: Leo1-like protein; supporting cDNA gi|21929714|gb|AF490422.1| Length = 625 Score = 31.1 bits (67), Expect = 0.52 Identities = 31/108 (28%), Positives = 48/108 (44%), Gaps = 2/108 (1%) Frame = +2 Query: 200 RGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKK 379 R + +E E+E E+E + + EK RGR G+D + EE A ++ Sbjct: 511 RPSRRQMEYSESEREESEYETEEEEEEKSPARGR-------GKDSEDEYEEDA-----EE 558 Query: 380 NVEEPPVENXSTDEPSVEDEVAVSE-ENNPSEDGSETNG-HIEEEQVP 517 + EE N +DE E+EVA E + G + G +EE+ P Sbjct: 559 DEEERGKSNRYSDEDEEEEEVAGGRAEKDHRGSGRKRKGIESDEEESP 606 >At5g38720.1 68418.m04683 expressed protein predicted protein, Drosophila melanogaster Length = 306 Score = 31.1 bits (67), Expect = 0.52 Identities = 23/86 (26%), Positives = 39/86 (45%) Frame = +2 Query: 218 VEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPP 397 + +P E++ E ++ KTK+ RKA T E+ K E K +KK Sbjct: 88 ISEPILEAISTEKVKEKKGKMNKTKKKRKAEEITRSSVEDLKRESKFKKSNKKKK----- 142 Query: 398 VENXSTDEPSVEDEVAVSEENNPSED 475 ++ S E +E+E V + ++ ED Sbjct: 143 MDMTSKKENKIEEEEDVYQISSGDED 168 >At3g56570.1 68416.m06290 SET domain-containing protein low similarity to SP|Q43088 Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N- methyltransferase, chloroplast precursor (EC 2.1.1.127) {Pisum sativum}; contains Pfam profile PF00856: SET domain Length = 531 Score = 31.1 bits (67), Expect = 0.52 Identities = 20/70 (28%), Positives = 30/70 (42%) Frame = +2 Query: 275 SEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSE 454 SE AA +T +DE ++P++ + EE P EN + E+E E Sbjct: 212 SEADESDNDDAANETTDEDEPSSKISSSPEQ----SFEEVPGENTDDEAKEEEEEEEEEE 267 Query: 455 ENNPSEDGSE 484 E E+G E Sbjct: 268 EGEEEEEGEE 277 >At3g43530.1 68416.m04621 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 615 Score = 31.1 bits (67), Expect = 0.52 Identities = 32/113 (28%), Positives = 49/113 (43%), Gaps = 5/113 (4%) Frame = +2 Query: 191 KKGRGK-AKVVEDPETESVEAEVDE-KNIVS---EKKTKRGRKAAGDTNGQDENGKIEET 355 KKG+GK A + P E + V+E KN++ + KR + QD+ K+ ET Sbjct: 343 KKGKGKTAAALTSPSDEGLTEVVNEMKNLMENGFKSMNKRMTNFSKKYEEQDKRLKLMET 402 Query: 356 APKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQV 514 A K + TD+ E+ + N E+GS+ NG E +V Sbjct: 403 AIKSIQSST---------GTDDAYGSKEI--DDRENELEEGSDANGGDNEREV 444 >At3g28510.1 68416.m03561 AAA-type ATPase family protein contains Pfam profile: PF00004 ATPase family Length = 530 Score = 31.1 bits (67), Expect = 0.52 Identities = 25/92 (27%), Positives = 47/92 (51%), Gaps = 2/92 (2%) Frame = +2 Query: 227 PETESVEAEVDEKNIVS--EKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPV 400 P+++ +A++ K +V E++ ++ RK A + +E K E+ A K K EE Sbjct: 439 PKSDEEDADICIKRLVKTLEEEKEKARKLAEE----EEKKKAEKEAKKM---KKAEEAEE 491 Query: 401 ENXSTDEPSVEDEVAVSEENNPSEDGSETNGH 496 + T+E +++V EEN + S+ NG+ Sbjct: 492 KKKKTEEDEKKEKVKAKEENG---NVSQQNGN 520 >At2g14140.1 68415.m01575 hypothetical protein similar to At2g04970, At2g15200, At1g32830, At3g30450, At4g03990, At5g34895, At3g47270, At2g02200 Length = 847 Score = 31.1 bits (67), Expect = 0.52 Identities = 29/99 (29%), Positives = 41/99 (41%), Gaps = 1/99 (1%) Frame = +2 Query: 221 EDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPV 400 ++ E E VE DE+ E + + G+ Q+E GK EE ++ VE Sbjct: 488 KEKEEEKVEYRGDEETEKQEIPKQGDEEMEGEEEKQEEEGKEEE-------EEKVEYRGD 540 Query: 401 ENXSTDE-PSVEDEVAVSEENNPSEDGSETNGHIEEEQV 514 E E P DE EE E+G E EEE++ Sbjct: 541 EGTEKQEIPKQGDEEMEGEEEKQEEEGKEE----EEEKI 575 >At5g03740.1 68418.m00335 zinc finger (C2H2 type) family protein contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 287 Score = 30.7 bits (66), Expect = 0.69 Identities = 18/55 (32%), Positives = 30/55 (54%) Frame = +2 Query: 350 ETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQV 514 + APK K+ + P E+ + +D+ SEE++ +D SE +G EEE+V Sbjct: 108 KAAPKSAAKQVNFQLPNEDVKAKQ---DDDADGSEEDSSDDDDSENSGDEEEEKV 159 >At5g03710.1 68418.m00331 hypothetical protein Length = 81 Score = 30.7 bits (66), Expect = 0.69 Identities = 17/62 (27%), Positives = 27/62 (43%) Frame = +2 Query: 323 GQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIE 502 G++E + EE ++ ++ EE E +E E+E EE E+ E E Sbjct: 5 GEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 64 Query: 503 EE 508 EE Sbjct: 65 EE 66 Score = 28.7 bits (61), Expect = 2.8 Identities = 16/58 (27%), Positives = 25/58 (43%) Frame = +2 Query: 338 GKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 511 G+ EE ++ ++ EE E +E E+E EE E+ E EEE+ Sbjct: 5 GEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 62 Score = 28.3 bits (60), Expect = 3.7 Identities = 16/61 (26%), Positives = 26/61 (42%) Frame = +2 Query: 329 DENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEE 508 +E + EE ++ ++ EE E +E E+E EE E+ E EEE Sbjct: 6 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 65 Query: 509 Q 511 + Sbjct: 66 E 66 Score = 27.5 bits (58), Expect = 6.4 Identities = 15/62 (24%), Positives = 27/62 (43%) Frame = +2 Query: 326 QDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEE 505 ++E + EE ++ ++ EE E +E E+E EE E+ E EE Sbjct: 7 EEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE 66 Query: 506 EQ 511 ++ Sbjct: 67 DR 68 >At4g37820.1 68417.m05351 expressed protein Kaposi's sarcoma-associated herpes-like virus ORF73gene, Kaposi's sarcoma-associated herpesvirus, U52064 Length = 532 Score = 30.7 bits (66), Expect = 0.69 Identities = 22/95 (23%), Positives = 42/95 (44%) Frame = +2 Query: 236 ESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXST 415 + + E DEK V + + K +G N +D + +E+ +K +K EE + Sbjct: 291 QQTKNEEDEKEKVQSSEEESKVKESG-KNEKDASSSQDESKEEKPERKKKEESSSQGEGK 349 Query: 416 DEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVPS 520 +E E E E+++ E+ E +E++ S Sbjct: 350 EE---EPEKREKEDSSSQEESKEEEPENKEKEASS 381 Score = 29.1 bits (62), Expect = 2.1 Identities = 26/102 (25%), Positives = 46/102 (45%), Gaps = 6/102 (5%) Frame = +2 Query: 176 DNDAPKKGRGKAKVVEDPET--ESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDE--NGK 343 +++ K G V D E E VE E +EK + E+ ++ + G+ G ++ NG+ Sbjct: 84 EDEEGSKNEGGGDVSTDKENGDEIVEREEEEKAV--EENNEKEAEGTGNEEGNEDSNNGE 141 Query: 344 IEETAPKK--GRKKNVEEPPVENXSTDEPSVEDEVAVSEENN 463 E+ + G + + EE N D+ S E E++N Sbjct: 142 SEKVVDESEGGNEISNEEAREINYKGDDASSEVMHGTEEKSN 183 >At1g76770.1 68414.m08934 heat shock protein-related contains similarity to 17.9 kDa heat-shock protein [Helianthus annuus] gi|11990130|emb|CAB55634 Length = 244 Score = 30.7 bits (66), Expect = 0.69 Identities = 19/61 (31%), Positives = 28/61 (45%) Frame = +2 Query: 341 KIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVPS 520 KIEE ++ K+ + E E + E +++E EEN E+ E EEE V Sbjct: 136 KIEEEDEEEEMKEPIVEEKTEEKTEPEEEIKEETKPEEEN---EEAEEPQREEEEEVVEE 192 Query: 521 G 523 G Sbjct: 193 G 193 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +2 Query: 347 EETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSE 484 E+T P++ K+ + P EN +EP E+E V EE +G + Sbjct: 157 EKTEPEEEIKEETK-PEEENEEAEEPQREEEEEVVEEGTRDHEGKK 201 Score = 27.9 bits (59), Expect = 4.9 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = +2 Query: 206 KAKVVEDPETE-SVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKK 379 K + +PE E E + +E+N +E+ + + + +D GK EE K RKK Sbjct: 154 KTEEKTEPEEEIKEETKPEEENEEAEEPQREEEEEVVEEGTRDHEGKKEEEIEDKPRKK 212 >At1g67580.1 68414.m07699 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 752 Score = 30.7 bits (66), Expect = 0.69 Identities = 24/92 (26%), Positives = 37/92 (40%) Frame = +2 Query: 221 EDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPV 400 +D + + E DE + + R AAG+++ DE +EE KK RKK PV Sbjct: 247 DDKQEHATHLEEDEN--MPTRHISSSRWAAGNSSPTDEVEIVEEVGEKKRRKKPF---PV 301 Query: 401 ENXSTDEPSVEDEVAVSEENNPSEDGSETNGH 496 + + + + E S D E H Sbjct: 302 QGRFRNTSQTPEVGELVREGYRSSDSDERGHH 333 >At5g61150.2 68418.m07672 leo1-like family protein weak similarity to SP|P38439 LEO1 protein {Saccharomyces cerevisiae}; contains Pfam profile PF04004: Leo1-like protein; supporting cDNA gi|21929714|gb|AF490422.1| Length = 623 Score = 30.3 bits (65), Expect = 0.91 Identities = 27/106 (25%), Positives = 46/106 (43%) Frame = +2 Query: 200 RGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKK 379 R + +E E+E E+E + + EK RGR G+D + EE A ++ Sbjct: 511 RPSRRQMEYSESEREESEYETEEEEEEKSPARGR-------GKDSEDEYEEDA-----EE 558 Query: 380 NVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVP 517 + EE N +DE E+E +E+++ +EE+ P Sbjct: 559 DEEERGKSNRYSDEDEEEEEGGRAEKDHRGSGRKRKGIESDEEESP 604 Score = 28.3 bits (60), Expect = 3.7 Identities = 18/59 (30%), Positives = 28/59 (47%) Frame = +2 Query: 347 EETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVPSG 523 EE +P +GR K+ E+ E+ DE S+E+ E+G G E++ SG Sbjct: 536 EEKSPARGRGKDSEDEYEEDAEEDEEERGKSNRYSDEDEEEEEG----GRAEKDHRGSG 590 >At5g22650.2 68418.m02647 expressed protein non-consensus AT donor splice site at exon 3, AC acceptor splice site at exon 4; Length = 223 Score = 30.3 bits (65), Expect = 0.91 Identities = 22/94 (23%), Positives = 36/94 (38%) Frame = +2 Query: 212 KVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEE 391 K D E ES + + E++ SEK + D +D + EE PKK N + Sbjct: 68 KPESDEEDESDDEDESEEDDDSEKGMDVDEDDSDDDEEEDSEDEEEEETPKKPEPINKKR 127 Query: 392 PPVENXSTDEPSVEDEVAVSEENNPSEDGSETNG 493 P T + + A + + P + + G Sbjct: 128 PNESVSKTPVSGKKAKPAAAPASTPQKTEEKKKG 161 >At5g22650.1 68418.m02646 expressed protein non-consensus AT donor splice site at exon 3, AC acceptor splice site at exon 4; Length = 306 Score = 30.3 bits (65), Expect = 0.91 Identities = 22/94 (23%), Positives = 36/94 (38%) Frame = +2 Query: 212 KVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEE 391 K D E ES + + E++ SEK + D +D + EE PKK N + Sbjct: 151 KPESDEEDESDDEDESEEDDDSEKGMDVDEDDSDDDEEEDSEDEEEEETPKKPEPINKKR 210 Query: 392 PPVENXSTDEPSVEDEVAVSEENNPSEDGSETNG 493 P T + + A + + P + + G Sbjct: 211 PNESVSKTPVSGKKAKPAAAPASTPQKTEEKKKG 244 >At2g24990.1 68415.m02988 RIO1 family protein similar to extragenic suppressor of the bimD6 mutation (SUDD) [Emericella nidulans] GI:2338556, RIO1 [Saccharomyces cerevisiae] GI:1359602; contains Pfam profile PF01163: RIO1 family Length = 537 Score = 30.3 bits (65), Expect = 0.91 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Frame = +2 Query: 317 TNGQDENGKIEETAPK-KGRKKNVEEPPVE--NXSTDEPSVEDEVAVSEENNPSEDGSET 487 T+GQD + +T K +EE +E + +E E+E SEE + E+ E Sbjct: 431 TSGQDTGDMLYQTITGLKDALPKIEEQKIEVNDEEKEEEGEEEEDGESEEGSEEEESEEE 490 Query: 488 NGHIEEE 508 GH +++ Sbjct: 491 LGHEDKK 497 Score = 27.9 bits (59), Expect = 4.9 Identities = 20/72 (27%), Positives = 31/72 (43%) Frame = +2 Query: 179 NDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETA 358 ND K+ G+ + + E S E E +E+ +KK R + E+ K + Sbjct: 462 NDEEKEEEGEEEEDGESEEGSEEEESEEELGHEDKKAARKEHKKKVKEEKRESRKTKTPK 521 Query: 359 PKKGRKKNVEEP 394 K RKK V +P Sbjct: 522 SVKKRKKKVSKP 533 >At1g80810.1 68414.m09481 expressed protein similar to androgen-induced prostate proliferative shutoff associated protein (GI:4559410) [Homo sapiens]; similar to bimD (GI:168025) [Emericella nidulans] Length = 826 Score = 30.3 bits (65), Expect = 0.91 Identities = 26/112 (23%), Positives = 47/112 (41%), Gaps = 2/112 (1%) Frame = +2 Query: 182 DAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKT--KRGRKAAGDTNGQDENGKIEET 355 +A R + + ED ++ E D K + +E K K+ + G++ G+D + E Sbjct: 708 EAESDDRSEEQEYEDDCSDKKEQSQD-KGVEAETKEEEKQYPNSEGESEGEDSESEEEPK 766 Query: 356 APKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 511 + ++ EE E E E+E ++ S + SE EEE+ Sbjct: 767 WRETDDMEDDEEEEEEEIDHMEDEAEEEKEEVDDKEASANMSEIEKEEEEEE 818 >At1g01680.1 68414.m00086 U-box domain-containing protein Length = 308 Score = 30.3 bits (65), Expect = 0.91 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +2 Query: 350 ETAPKKGRKKNVEEPPVENXSTDEPSVED 436 E +PKKGRK+ +E+ N S ++P +ED Sbjct: 209 EESPKKGRKETIEKSK-SNESDEDPRLED 236 >At3g62800.2 68416.m07056 double-stranded RNA-binding domain (DsRBD)-containing protein weak similarity to SP|P19525 Interferon-induced, double-stranded RNA-activated protein kinase (EC 2.7.1.-) {Homo sapiens}; contains Pfam profile PF00035: Double-stranded RNA binding motif Length = 355 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 359 PKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGS 481 P KG K N +E P + + + E VA++E NP+ DG+ Sbjct: 195 PSKGIKVNEDEFPDLHDAPASNAKEINVALNEPENPTNDGT 235 >At3g62800.1 68416.m07055 double-stranded RNA-binding domain (DsRBD)-containing protein weak similarity to SP|P19525 Interferon-induced, double-stranded RNA-activated protein kinase (EC 2.7.1.-) {Homo sapiens}; contains Pfam profile PF00035: Double-stranded RNA binding motif Length = 355 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +2 Query: 359 PKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGS 481 P KG K N +E P + + + E VA++E NP+ DG+ Sbjct: 195 PSKGIKVNEDEFPDLHDAPASNAKEINVALNEPENPTNDGT 235 >At1g76810.1 68414.m08938 eukaryotic translation initiation factor 2 family protein / eIF-2 family protein similar to IF2 protein [Drosophila melanogaster] GI:7108770; contains Pfam profile PF03144: Elongation factor Tu domain 2 Length = 1294 Score = 29.9 bits (64), Expect = 1.2 Identities = 31/128 (24%), Positives = 57/128 (44%), Gaps = 8/128 (6%) Frame = +2 Query: 194 KGRGKAKVVEDPE----TE-SVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETA 358 K + K ++D E TE S E++V+E+ +V K+G+K QD++ + Sbjct: 27 KSKKKGAQIDDDEYSIGTELSEESKVEEEKVVVITGKKKGKKGNKKGTQQDDDDDFSDKV 86 Query: 359 PKKGRKKNVEEPPV---ENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVPSG*G 529 G K +V E + + A+ ++ + ED +E++G ++E V S G Sbjct: 87 SAAGVKDDVPEIAFVGKKKSKGKKGGGSVSFALLDDEDEKED-NESDGDKDDEPVISFTG 145 Query: 530 T*ETNXKG 553 + KG Sbjct: 146 KKHASKKG 153 >At5g53440.1 68418.m06641 expressed protein Length = 1181 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/71 (22%), Positives = 30/71 (42%) Frame = +2 Query: 290 KRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPS 469 K G+ + + K EE +KG K+ + P E+ +DE DE + + Sbjct: 228 KDGKHKGEKSRDKYREDKEEEDIKQKGDKQRDDRPTKEHLRSDEKLTRDESKKKSKFQDN 287 Query: 470 EDGSETNGHIE 502 + G E + ++ Sbjct: 288 DHGHEPDSELD 298 >At5g12410.1 68418.m01459 THUMP domain-containing protein contains Pfam profile PF02926: THUMP domain Length = 376 Score = 29.5 bits (63), Expect = 1.6 Identities = 24/84 (28%), Positives = 37/84 (44%), Gaps = 2/84 (2%) Frame = +2 Query: 176 DNDAPKKGRGKAKVVEDPE--TESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIE 349 D D G +V + E +E V +V+EK I SE + + A EN ++ Sbjct: 110 DGDKAVVSEGGNDLVNEKEIASEGVNDQVNEKEIASEGSCEVKQLA--------ENETVK 161 Query: 350 ETAPKKGRKKNVEEPPVENXSTDE 421 E K +K +EPP + T+E Sbjct: 162 EEEDKGNQKNGGDEPPRKKTCTEE 185 >At4g34400.1 68417.m04886 transcriptional factor B3 family protein contains Pfam profile PF02362: B3 DNA binding domain Length = 389 Score = 29.5 bits (63), Expect = 1.6 Identities = 22/81 (27%), Positives = 37/81 (45%) Frame = +2 Query: 194 KGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGR 373 KG+ K +VVED + + +E ++ SE + +T+ E + T PK + Sbjct: 153 KGKSKVEVVEDSDDDE-----EEDSVYSESSEET------ETDTDSEFKVAKPTIPKSQK 201 Query: 374 KKNVEEPPVENXSTDEPSVED 436 K +E VE+ +E ED Sbjct: 202 KGKKKEQVVESSDDEEDEEED 222 >At3g49990.1 68416.m05466 expressed protein Length = 502 Score = 29.5 bits (63), Expect = 1.6 Identities = 19/66 (28%), Positives = 35/66 (53%) Frame = +2 Query: 311 GDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETN 490 G+++G NG++E + ++ R++ +EP EN P DE+ E N S+ + Sbjct: 213 GESSGVS-NGELEFSVRREVRERESDEPVAENPRV--PRQIDELFDQLELNEYGSDSDGD 269 Query: 491 GHIEEE 508 G+I E+ Sbjct: 270 GYIAED 275 >At3g49470.1 68416.m05407 nascent polypeptide-associated complex (NAC) domain-containing protein similar to alpha-NAC, non-muscle form [Mus musculus] GI:1666690; contains Pfam profile PF01849: NAC domain Length = 217 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/63 (23%), Positives = 28/63 (44%) Frame = +2 Query: 320 NGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHI 499 +GQ E + A + +K +EP VE+ DE +D+ +++ GS Sbjct: 13 DGQPEQPPVTAIAEELEKKLQTDEPIVEDVKDDEDDDDDDEEEEDDDAQGVSGSSKQSRS 72 Query: 500 EEE 508 E++ Sbjct: 73 EKK 75 >At2g15860.1 68415.m01818 expressed protein and genefinder Length = 512 Score = 29.5 bits (63), Expect = 1.6 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 1/79 (1%) Frame = +2 Query: 200 RGKAKVVEDPETESVE-AEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRK 376 R A V E E EVDE + S K+ ++ +A + + DEN K++++A ++ Sbjct: 67 RNAAAVAEKAAKSIAEMGEVDEDSESSAKEEEKTEEADTEQDSDDENAKLKKSALERLEG 126 Query: 377 KNVEEPPVENXSTDEPSVE 433 + E + + SVE Sbjct: 127 ASEESLLSQGLKVFDDSVE 145 >At1g44810.1 68414.m05133 expressed protein contains Pfam profile: PF04504 protein of unknown function, DUF573 Length = 296 Score = 29.5 bits (63), Expect = 1.6 Identities = 20/91 (21%), Positives = 44/91 (48%), Gaps = 1/91 (1%) Frame = +2 Query: 218 VEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPP 397 +EDP T S +VDE+ E + ++ +++ +E ++++ + + + E P Sbjct: 9 LEDPPTASSSEDVDEEISSGEDE----KEHISNSSSSEEENELKDLSTQTLNSPSTEAPT 64 Query: 398 VENXS-TDEPSVEDEVAVSEENNPSEDGSET 487 +++ S T+ S + V S++ D S T Sbjct: 65 LDSGSETNSDSDKPIVLTSQKKKEGTDSSGT 95 >At1g15940.1 68414.m01913 expressed protein similar To androgen-induced prostate proliferative shutoff associated protein (GI:4559410) [Homo sapiens] Length = 990 Score = 29.5 bits (63), Expect = 1.6 Identities = 24/102 (23%), Positives = 45/102 (44%), Gaps = 2/102 (1%) Frame = +2 Query: 212 KVVED-PETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVE 388 K+ +D E E +E + +E ++ K++ D EN +E T ++ + Sbjct: 742 KIEKDCDEQEDLETKDEEDSLKLGKESDAEPDRMEDHQELPENHNVE-TKTDGEEQEAAK 800 Query: 389 EPPVENXST-DEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 511 EP E+ + +EP+ E E E + E +E EE++ Sbjct: 801 EPTAESKTNGEEPNAEPETDGKEHKSLKEPNAEPKSDGEEQE 842 Score = 27.9 bits (59), Expect = 4.9 Identities = 26/86 (30%), Positives = 39/86 (45%) Frame = +2 Query: 221 EDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPV 400 E PE +VE + D + E++ + A TNG++ N + ET K+ K+++EP Sbjct: 780 ELPENHNVETKTDGE----EQEAAKEPTAESKTNGEEPNAE-PETDGKE--HKSLKEPNA 832 Query: 401 ENXSTDEPSVEDEVAVSEENNPSEDG 478 E S E E E A DG Sbjct: 833 EPKSDGE---EQEAAKEPNAELKTDG 855 >At5g62750.1 68418.m07877 expressed protein predicted proteins, Caenorhabditis elegans Length = 124 Score = 29.1 bits (62), Expect = 2.1 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +2 Query: 221 EDPETESVEAEVDEKNIVSEKKTKR-GRKAAGDTNGQDENGKIEETAPKKGRKKNVEE 391 E+ ++ +AE EK +KK K K G G+D+ K ++ K ++KN E+ Sbjct: 15 EEEHNKAEKAEKKEKKKDKDKKDKNEDDKNGGGEEGEDQEKKSKKKDKKAKKEKNPED 72 Score = 27.5 bits (58), Expect = 6.4 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = +2 Query: 275 SEKKTKRGRKAAGDTNGQDENGKIE--ETAPKKGRKKNVEEPPVEN 406 +EKK K+ K D N D+NG E E KK +KK+ + +N Sbjct: 24 AEKKEKKKDKDKKDKNEDDKNGGGEEGEDQEKKSKKKDKKAKKEKN 69 >At5g24880.1 68418.m02946 expressed protein ; expression supported by MPSS Length = 443 Score = 29.1 bits (62), Expect = 2.1 Identities = 24/99 (24%), Positives = 43/99 (43%) Frame = +2 Query: 218 VEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPP 397 +E+P+ E E EV EK + + + + +++G T GK + +EE Sbjct: 220 IEEPKYEKEEKEVQEKVVQANESVEEKAESSGPTPVASPVGKDCNAVVAE-----LEEKL 274 Query: 398 VENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQV 514 ++N ED++ E +D ++ N EEE V Sbjct: 275 IKN--------EDDIEEKTEEMKEQDNNQANKSEEEEDV 305 Score = 27.9 bits (59), Expect = 4.9 Identities = 29/111 (26%), Positives = 49/111 (44%), Gaps = 6/111 (5%) Frame = +2 Query: 197 GRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEET-APKKGR 373 G+ VV + E + ++ E D + E K + +A +D KI+E P+K Sbjct: 260 GKDCNAVVAELEEKLIKNEDDIEEKTEEMKEQDNNQANKSEEEEDVKKKIDENETPEKVD 319 Query: 374 KKNVEEPPVENXSTD-EPSVEDE--VAVSEENNPSEDGSETNGH--IEEEQ 511 ++ E VE + + E V++E V EE E E + +EEE+ Sbjct: 320 TESKEVESVEETTQEKEEEVKEEGKERVEEEEKEKEKVKEDDQKEKVEEEE 370 >At5g10660.1 68418.m01234 calmodulin-binding protein-related contains weak similarity to calmodulin-binding proteins Length = 407 Score = 29.1 bits (62), Expect = 2.1 Identities = 26/118 (22%), Positives = 49/118 (41%), Gaps = 8/118 (6%) Frame = +2 Query: 182 DAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKK----TKRGRKAAGDTNGQ----DEN 337 + PKK GK + + A DE+ IV + + G + + Q DE+ Sbjct: 182 NVPKKSSGKE--ISPDSSPLASAHEDEEEIVKVETDVHISDHGEEPKEEDKDQFAQPDES 239 Query: 338 GKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 511 G+ +ET+P + + ++ + E E + + E N SE+ E ++E+ Sbjct: 240 GEEKETSPVAASTEEQKGELIDEDKSTEQIEEPKEPENIEENNSEEEEEVKKKSDDEE 297 >At4g28080.1 68417.m04027 expressed protein Length = 1660 Score = 29.1 bits (62), Expect = 2.1 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +2 Query: 326 QDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPS-EDGSETNGHIE 502 Q ++G + E P G + + E + D+ + ED+ AV +E + E+G T G +E Sbjct: 1567 QPQDGLVSEELPGAGSSEE-KSGSEEESNNDKNAGEDDEAVGQETTDTPENGHSTVGEVE 1625 >At4g04400.1 68417.m00634 hypothetical protein contains Pfam profile PF03384: Drosophila protein of unknown function, DUF287 Length = 735 Score = 29.1 bits (62), Expect = 2.1 Identities = 27/110 (24%), Positives = 45/110 (40%) Frame = +2 Query: 182 DAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAP 361 D+ +K + T +E + D ++V K AA D D +ETA Sbjct: 14 DSTEKSSSGEVSTSEQVTSEIENDGDAADLVPTKPAGLTEPAARDVAANDTT---KETAE 70 Query: 362 KKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 511 + K +EEP + ++ + + E E A+ E E + IEE+Q Sbjct: 71 IE---KALEEPRDGDEASPKGTAEIEKAMEEPRVGDEASPKGTAEIEEDQ 117 >At3g12340.1 68416.m01538 immunophilin, putative / FKBP-type peptidyl-prolyl cis-trans isomerase, putative contains Pfam profile: PF00254, FKBP-type peptidyl-prolyl cis-trans isomerases Length = 694 Score = 29.1 bits (62), Expect = 2.1 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 5/70 (7%) Frame = +2 Query: 191 KKGRGKAKVVED-PETESVEAEVDEKNIVSEKKTKRGRKAAGDTNG---QD-ENGKIEET 355 KK R + + D PE + + +KNI E TK+ + +NG +D E GK++ Sbjct: 542 KKKRDRREETTDVPECPEKKKQAIDKNIEKEAGTKKPLETRTLSNGVIIEDIEKGKLDGK 601 Query: 356 APKKGRKKNV 385 + KG+K ++ Sbjct: 602 SAVKGKKVSI 611 >At1g21630.1 68414.m02708 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain; ESTs gb|T44428 and gb|AA395440 come from this gene Length = 1218 Score = 29.1 bits (62), Expect = 2.1 Identities = 11/54 (20%), Positives = 28/54 (51%) Frame = +2 Query: 209 AKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKG 370 +K ED +++ +K E+ +++ D + +D+NG ++++ +KG Sbjct: 808 SKEGEDVSFSDADSKTGKKQSSGEEDSEQSEGKTSDVDARDKNGSLDDSKVRKG 861 >At5g64910.1 68418.m08165 expressed protein ; expression supported by MPSS Length = 487 Score = 28.7 bits (61), Expect = 2.8 Identities = 21/86 (24%), Positives = 39/86 (45%) Frame = +2 Query: 227 PETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVEN 406 P E+ E E ++ E++ K +A + N ++E K+E A ++G + + E Sbjct: 45 PTQETEETEDKVESPAPEEEGKNEEEA--NENQEEEAAKVESKAAEEGGNEEEAKEDKEE 102 Query: 407 XSTDEPSVEDEVAVSEENNPSEDGSE 484 +E + ED+ E P E S+ Sbjct: 103 EK-EEAAREDKEEEEEAVKPDESASQ 127 >At5g61330.1 68418.m07696 rRNA processing protein-related contains weak similarity to rRNA processing protein EBP2 (EBNA1-binding protein homolog) (Swiss-Prot:P36049) [Saccharomyces cerevisiae] Length = 436 Score = 28.7 bits (61), Expect = 2.8 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 1/75 (1%) Frame = +2 Query: 287 TKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDE-PSVEDEVAVSEENN 463 +KR ++A D+ +D I + K N ++ + DE S+ED+ SEE++ Sbjct: 5 SKRSKRARLDSESED----ISDQENLKAESDNEDDQLPDGIEDDEVDSMEDDEGESEEDD 60 Query: 464 PSEDGSETNGHIEEE 508 + + G EE+ Sbjct: 61 EGDTEEDDEGDSEED 75 >At5g52040.2 68418.m06459 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 357 Score = 28.7 bits (61), Expect = 2.8 Identities = 19/81 (23%), Positives = 34/81 (41%), Gaps = 5/81 (6%) Frame = +2 Query: 176 DNDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQD-----ENG 340 + +P GRG + V E S + ++ K+ + D ++ ENG Sbjct: 199 ERGSPDYGRGASPVAHKRERTSPDYGRGRRSPSPYKRARLSPDYKRDDRRRERVASPENG 258 Query: 341 KIEETAPKKGRKKNVEEPPVE 403 + +P+KGR ++ PP E Sbjct: 259 AVRNRSPRKGRGESRSPPPYE 279 >At5g52040.1 68418.m06458 arginine/serine-rich splicing factor RSP41 (RSP41) nearly identical to SP|P92966 Arginine/serine-rich splicing factor RSP41 {Arabidopsis thaliana} Length = 356 Score = 28.7 bits (61), Expect = 2.8 Identities = 19/81 (23%), Positives = 34/81 (41%), Gaps = 5/81 (6%) Frame = +2 Query: 176 DNDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQD-----ENG 340 + +P GRG + V E S + ++ K+ + D ++ ENG Sbjct: 199 ERGSPDYGRGASPVAHKRERTSPDYGRGRRSPSPYKRARLSPDYKRDDRRRERVASPENG 258 Query: 341 KIEETAPKKGRKKNVEEPPVE 403 + +P+KGR ++ PP E Sbjct: 259 AVRNRSPRKGRGESRSPPPYE 279 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 28.7 bits (61), Expect = 2.8 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 320 NGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVE 433 N +D++G EET ++ R+ + PP E S + PS E Sbjct: 79 NDKDQSGGEEETTSRRKRRSRWDPPPSE--SINNPSAE 114 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 28.7 bits (61), Expect = 2.8 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +2 Query: 320 NGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVE 433 N +D++G EET ++ R+ + PP E S + PS E Sbjct: 79 NDKDQSGGEEETTSRRKRRSRWDPPPSE--SINNPSAE 114 >At5g16500.1 68418.m01928 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 636 Score = 28.7 bits (61), Expect = 2.8 Identities = 18/68 (26%), Positives = 30/68 (44%), Gaps = 3/68 (4%) Frame = +2 Query: 296 GRKAAGDTNGQDENGKIEETAPKKGR---KKNVEEPPVENXSTDEPSVEDEVAVSEENNP 466 G K++ ++ +DE + E+ A K+ KK E+ S DE E EE + Sbjct: 397 GNKSSSSSDSEDEEEEKEQKAEKEEESTSKKRQEQEETATDSDDESDSNSEKDQEEEQSQ 456 Query: 467 SEDGSETN 490 E E++ Sbjct: 457 LEKARESS 464 >At4g31880.1 68417.m04531 expressed protein Length = 873 Score = 28.7 bits (61), Expect = 2.8 Identities = 23/92 (25%), Positives = 35/92 (38%), Gaps = 3/92 (3%) Frame = +2 Query: 206 KAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNV 385 K + P SV A +N ++ K +GD + + E P++ K Sbjct: 393 KDVLTSPPVDSSVTAATSSENEKNKSVQILPSKTSGDETANVSSPSMAEELPEQSVPKKT 452 Query: 386 EEPPVENXSTDEPSVEDEVA---VSEENNPSE 472 + ST+E +A VSEE N SE Sbjct: 453 ANQKKKESSTEEVKPSASIATEEVSEEPNTSE 484 Score = 27.1 bits (57), Expect = 8.5 Identities = 21/84 (25%), Positives = 37/84 (44%), Gaps = 1/84 (1%) Frame = +2 Query: 239 SVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTD 418 + E + D ++ + EK+ + D + + + E A K + PPV++ T Sbjct: 348 TTEEKPDVEHQIEEKENESSSVKQADLSKDSDIKEETEPAELLDSKDVLTSPPVDSSVTA 407 Query: 419 EPSVEDEVAVSEENNPSE-DGSET 487 S E+E S + PS+ G ET Sbjct: 408 ATSSENEKNKSVQILPSKTSGDET 431 >At4g29680.1 68417.m04228 type I phosphodiesterase/nucleotide pyrophosphatase family protein similar to SP|P06802 Ectonucleotide pyrophosphatase/phosphodiesterase 1 (Plasma-cell membrane glycoprotein PC-1) [Includes: Alkaline phosphodiesterase I (EC 3.1.4.1); Nucleotide pyrophosphatase (EC 3.6.1.9) {Mus musculus}; contains Pfam profile PF01663: Type I phosphodiesterase / nucleotide pyrophosphatase Length = 496 Score = 28.7 bits (61), Expect = 2.8 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -3 Query: 355 CFLYFTILILSICVTGSFPSAFGFLF 278 CF+ FT L+L C+ S SAF FLF Sbjct: 50 CFI-FTSLLLVTCIALSAASAFAFLF 74 >At4g26780.1 68417.m03857 co-chaperone grpE family protein similar to chaperone GrpE type 2 [Nicotiana tabacum] GI:3851640; contains Pfam profile PF01025: co-chaperone GrpE Length = 327 Score = 28.7 bits (61), Expect = 2.8 Identities = 22/94 (23%), Positives = 35/94 (37%), Gaps = 2/94 (2%) Frame = +2 Query: 233 TESVEAEVDEKNIVSEKKTKRGRKAAGDTN--GQDENGKIEETAPKKGRKKNVEEPPVEN 406 + S E DEK +E K + N G D K T K ++K + + Sbjct: 68 SSSTSPESDEKKTHTEASKTSEEKPTAEANQPGLDSESKDSVTDSAKRKRKGAKGAASSS 127 Query: 407 XSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEE 508 +D S +DE++ + + E EEE Sbjct: 128 SESDSESDDDELSADDLVKLVAEKEELLSEKEEE 161 >At4g26110.1 68417.m03759 nucleosome assembly protein (NAP), putative similar to nucleosome assembly protein 1 [Glycine max] GI:1161252; contains Pfam profile PF00956: Nucleosome assembly protein (NAP) Length = 372 Score = 28.7 bits (61), Expect = 2.8 Identities = 17/67 (25%), Positives = 27/67 (40%) Frame = +2 Query: 221 EDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPV 400 E E E E + DE++ + E + + + D + +DE + P G KK V Sbjct: 298 EAMEAEDFEIDDDEEDDIDEDEDEEDEEDEEDDDDEDEEESKTKKKPSIGNKKGGRSQIV 357 Query: 401 ENXSTDE 421 DE Sbjct: 358 GEGKQDE 364 >At4g16830.1 68417.m02540 nuclear RNA-binding protein (RGGA) identical to nuclear RNA binding protein GI:6492264 from [Arabidopsis thaliana] Length = 355 Score = 28.7 bits (61), Expect = 2.8 Identities = 25/100 (25%), Positives = 48/100 (48%), Gaps = 7/100 (7%) Frame = +2 Query: 215 VVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEP 394 VVE+ E E E +DE + E+K K + T+ + + K+ E+ + KK+ +E Sbjct: 215 VVEEKEPEDKEMTLDEYEKILEEKKKALQSLT--TSERKVDTKVFESMQQLSNKKSNDEI 272 Query: 395 PVENXSTDEPSVEDE-------VAVSEENNPSEDGSETNG 493 ++ S + +D+ V+++E P+E G+ G Sbjct: 273 FIKLGSDKDKRKDDKEEKAKKAVSINEFLKPAEGGNYYRG 312 >At3g49540.1 68416.m05414 expressed protein Length = 166 Score = 28.7 bits (61), Expect = 2.8 Identities = 25/92 (27%), Positives = 41/92 (44%) Frame = +2 Query: 203 GKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKN 382 G A ++ + ++ E V K VSE K +G+ +N + ET + Sbjct: 3 GCASRPKESDMQNEEGSVPNKP-VSENVVA---KENNTESGEKQNQTVAETTETTSVEAK 58 Query: 383 VEEPPVENXSTDEPSVEDEVAVSEENNPSEDG 478 E PVE P+V+ EVA EE++ ++ G Sbjct: 59 -ETFPVEPTKETTPAVQPEVAAVEESSSADAG 89 >At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar to RNA helicase [Rattus norvegicus] GI:897915; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 1166 Score = 28.7 bits (61), Expect = 2.8 Identities = 22/105 (20%), Positives = 48/105 (45%), Gaps = 3/105 (2%) Frame = +2 Query: 206 KAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKA-AGDTNGQDENGKIEETAPKKGRKKN 382 K++ D E + + EK +++ KR + + + D +D++ + E+ K+ ++ Sbjct: 24 KSRRDRDRSNERKKDKGSEKRREKDRRKKRVKSSDSEDDYDRDDDEEREKRKEKERERRR 83 Query: 383 VEEPPVENXSTDEPSV--EDEVAVSEENNPSEDGSETNGHIEEEQ 511 ++ V+ S S ED+V +E + + GH E E+ Sbjct: 84 RDKDRVKRRSERRKSSDSEDDVEEEDERDKRRVNEKERGHREHER 128 >At1g18950.1 68414.m02358 aminoacyl-tRNA synthetase family contains aminoacyl-transfer RNA synthetases class-II signature 1, PROSITE:PS00179 Length = 766 Score = 28.7 bits (61), Expect = 2.8 Identities = 13/62 (20%), Positives = 31/62 (50%) Frame = +2 Query: 329 DENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEE 508 DE G + T + ++N +P ++ +EP ++ A + + +++NG ++E Sbjct: 667 DETGNGDFTMGSQDSEENANDPETKSGEEEEPRDVNDNADTTNGKENNQLNKSNGTTDQE 726 Query: 509 QV 514 +V Sbjct: 727 EV 728 >At5g58590.1 68418.m07342 Ran-binding protein 1, putative / RanBP1, putative strong similarity to Ran binding proteins from Arabidopsis thaliana atranbp1a [Arabidopsis thaliana] GI:2058282, atranbp1b [Arabidopsis thaliana] GI:2058284; contains Pfam profile PF00638: RanBP1 domain Length = 219 Score = 28.3 bits (60), Expect = 3.7 Identities = 13/39 (33%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +2 Query: 398 VENXSTDEPSVEDEVAVSEENNPSEDGSETNGH-IEEEQ 511 +EN S +E E++ +EE P+++ ET +EEE+ Sbjct: 175 IENLSVEENISEEKAKEAEEKEPAKEDKETKKEKVEEEK 213 >At5g37190.1 68418.m04465 COP1-interacting protein 4 (CIP4) similar to COP1-interacting protein 4 (CIP4) [Arabidopsis thaliana] GI:13160646; supporting cDNA gi|13160645|dbj|AB036832.1|; Length = 876 Score = 28.3 bits (60), Expect = 3.7 Identities = 23/96 (23%), Positives = 37/96 (38%), Gaps = 4/96 (4%) Frame = +2 Query: 230 ETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNV---EEPPV 400 E V + +K E K G+K++ T +D +EE NV E P+ Sbjct: 535 EEAQVVDSLQQKKEAEENLEKSGKKSSKKTKKKDSLNIVEEAQVLSVEVNNVAQEEASPI 594 Query: 401 ENXSTDEPSVEDEVAVSEEN-NPSEDGSETNGHIEE 505 N + S +E N +P + SE + E+ Sbjct: 595 NNPKDTDASFTPAKKTTESNASPLKKISEVTDNTED 630 >At5g10950.1 68418.m01271 cylicin-related low similarity to SP|Q28092 Cylicin II (Multiple-band polypeptide II) {Bos taurus} Length = 395 Score = 28.3 bits (60), Expect = 3.7 Identities = 27/91 (29%), Positives = 38/91 (41%), Gaps = 12/91 (13%) Frame = +2 Query: 248 AEVDEKNIVSEKKTKRGRKAAGDTN---GQDENGKIEETAPK--KGRKKNVEEPPVENXS 412 ++ +K +S K TKR D + G D + EE PK K N +E + Sbjct: 198 SKASKKPKMSSKLTKRKHTDDQDEDEEAGDDIDTSSEEAKPKVLKSCNSNADEVAENSSD 257 Query: 413 TDEPSV-------EDEVAVSEENNPSEDGSE 484 DEP V D+ EEN S+D +E Sbjct: 258 EDEPKVLKTNNSKADKDEDEEENETSDDEAE 288 >At3g12380.1 68416.m01543 actin/actin-like family protein similar to SP|P53946 Actin-like protein ARP5 {Saccharomyces cerevisiae}; contains Pfam profile PF00022: Actin Length = 724 Score = 28.3 bits (60), Expect = 3.7 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +2 Query: 221 EDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKI 346 E+PE+ E + K ++ + K+ K G +NG +++G I Sbjct: 444 ENPESYLEELQAQYKEVLERVEQKKRLKTNGSSNGNNKSGGI 485 >At3g05900.1 68416.m00664 neurofilament protein-related similar to NF-180 (GI:632549) [Petromyzon marinus] similar to Neurofilament triplet H protein (200 kDa neurofilament protein) (Neurofilament heavy polypeptide) (NF-H) (Swiss-Prot:P12036) [Homo sapiens] Length = 673 Score = 28.3 bits (60), Expect = 3.7 Identities = 30/97 (30%), Positives = 40/97 (41%) Frame = +2 Query: 176 DNDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEET 355 + D P K + D + E DE+ VSE K + AA +DEN K + Sbjct: 509 EGDVPSPADVIEKAITDEKHVVEEPLKDEQENVSEAKDVVTKLAA-----EDENIKKDTD 563 Query: 356 APKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNP 466 P K EE E TD SVE E A +++ P Sbjct: 564 TPVAEGKS--EETLKE---TDTESVEKEAAANKQEEP 595 Score = 27.5 bits (58), Expect = 6.4 Identities = 29/92 (31%), Positives = 45/92 (48%), Gaps = 1/92 (1%) Frame = +2 Query: 209 AKVVEDPETESVEA-EVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNV 385 A++ E+ + + VEA EV+ K SEK + KA + + E K EETA + K Sbjct: 226 AEIAEE-KVKDVEALEVEPKPETSEKVETQLEKAR-ELETEVEVVKAEETAEATEQAKVE 283 Query: 386 EEPPVENXSTDEPSVEDEVAVSEENNPSEDGS 481 E +E+ +E +D S++ SE GS Sbjct: 284 LEGKLEDVIVEE---KDSEINSKDEKTSESGS 312 >At2g18220.1 68415.m02123 expressed protein contains Pfam domain PF03715: Uncharacterised protein family (UPF0120) Length = 779 Score = 28.3 bits (60), Expect = 3.7 Identities = 20/59 (33%), Positives = 29/59 (49%) Frame = +2 Query: 176 DNDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEE 352 D D +KG P ++S E E +E+ +KK KRG K+ + QDE G E+ Sbjct: 656 DEDRMEKGAAAFNSSWLPGSDSKEKEPEEEK-TKKKKRKRGGKSKTEKK-QDEQGLGED 712 >At2g02795.1 68415.m00223 hypothetical protein Length = 168 Score = 28.3 bits (60), Expect = 3.7 Identities = 12/45 (26%), Positives = 23/45 (51%) Frame = -3 Query: 388 LYILLPSFFWCCFLYFTILILSICVTGSFPSAFGFLFRYNVLFIN 254 +Y+ L + + F +IL + IC +F F ++ R +V +N Sbjct: 64 IYVALWAMLFSMFQQISILFMCICGVSAFMGLFNYIHRLSVGVLN 108 >At1g67180.1 68414.m07642 zinc finger (C3HC4-type RING finger) family protein / BRCT domain-containing protein contains Pfam domains PF00533: BRCA1 C Terminus (BRCT) domain and PF00097: Zinc finger, C3HC4 type (RING finger) Length = 453 Score = 28.3 bits (60), Expect = 3.7 Identities = 22/82 (26%), Positives = 40/82 (48%), Gaps = 1/82 (1%) Frame = +2 Query: 260 EKNIVSEKKTKRGR-KAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVED 436 EKN+ + + + R R K EN + E++ +KG+K+ V++ N E ++ Sbjct: 140 EKNVEANRHSVRLRTKRPSSILENKENSGVAESS-RKGKKRVVKQRSYRNLIDLES--DE 196 Query: 437 EVAVSEENNPSEDGSETNGHIE 502 E + +N E+ +ET H E Sbjct: 197 ESDNNHHDNSDENQNETQDHRE 218 >At1g64330.1 68414.m07290 myosin heavy chain-related similar to myosin heavy chain (GI:1850913) [Entamoeba histolytica]; similar to Intracellular protein transport protein USO1 (Swiss-Prot:P25386) [Saccharomyces cerevisiae] Length = 555 Score = 28.3 bits (60), Expect = 3.7 Identities = 23/98 (23%), Positives = 50/98 (51%), Gaps = 9/98 (9%) Frame = +2 Query: 245 EAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEP 424 E+++++K + KK + G +A + +D +EE +G +KN E +E ++P Sbjct: 197 ESDLNQK-LEDVKKERDGLEAELASKAKDHESTLEEVNRLQG-QKNETEAELEREKQEKP 254 Query: 425 SVEDEV-----AVSEE----NNPSEDGSETNGHIEEEQ 511 ++ +++ A+ E+ N S++ + NG EE + Sbjct: 255 ALLNQINDVQKALLEQEAAYNTLSQEHKQINGLFEERE 292 >At1g56110.1 68414.m06443 nucleolar protein Nop56, putative similar to XNop56 protein [Xenopus laevis] GI:14799394; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 522 Score = 28.3 bits (60), Expect = 3.7 Identities = 23/72 (31%), Positives = 33/72 (45%) Frame = +2 Query: 176 DNDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEET 355 D K + KAK E+ E ++E + EK +KK KR + A +EN K E+ Sbjct: 442 DASVKKSKKKKAKGEEEEEVVAMEEDKSEK---KKKKEKRKMETA------EENEKSEKK 492 Query: 356 APKKGRKKNVEE 391 KK + EE Sbjct: 493 KTKKSKAGGEEE 504 >At1g48760.2 68414.m05457 delta-adaptin, putative similar to SP|O14617 Adapter-related protein complex 3 delta 1 subunit (Delta-adaptin 3) {Homo sapiens}; contains Pfam profile: PF01602 Adaptin N terminal region Length = 869 Score = 28.3 bits (60), Expect = 3.7 Identities = 19/89 (21%), Positives = 39/89 (43%), Gaps = 3/89 (3%) Frame = +2 Query: 200 RGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQ---DENGKIEETAPKKG 370 + K + + ES+ + +V K ++ R +GQ +E+ +IE + Sbjct: 772 QAKTNIQTANDDESLSRAIQSALLVKNKGKEKDRYEGNPNSGQQEKEESSRIENHQNSEK 831 Query: 371 RKKNVEEPPVENXSTDEPSVEDEVAVSEE 457 +KK ++ E S + ++EVA + E Sbjct: 832 KKKKKKKKKGEGSSKHKSRRQNEVASASE 860 >At1g48760.1 68414.m05456 delta-adaptin, putative similar to SP|O14617 Adapter-related protein complex 3 delta 1 subunit (Delta-adaptin 3) {Homo sapiens}; contains Pfam profile: PF01602 Adaptin N terminal region Length = 869 Score = 28.3 bits (60), Expect = 3.7 Identities = 19/89 (21%), Positives = 39/89 (43%), Gaps = 3/89 (3%) Frame = +2 Query: 200 RGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQ---DENGKIEETAPKKG 370 + K + + ES+ + +V K ++ R +GQ +E+ +IE + Sbjct: 772 QAKTNIQTANDDESLSRAIQSALLVKNKGKEKDRYEGNPNSGQQEKEESSRIENHQNSEK 831 Query: 371 RKKNVEEPPVENXSTDEPSVEDEVAVSEE 457 +KK ++ E S + ++EVA + E Sbjct: 832 KKKKKKKKKGEGSSKHKSRRQNEVASASE 860 >At1g23070.1 68414.m02884 hypothetical protein contains Pfam profile PF03619: Domain of unknown function Length = 414 Score = 28.3 bits (60), Expect = 3.7 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = -3 Query: 385 YILLPSFFWCCFLYFTILILSICVTGSFPSAFGFLFRYNVLFINFS 248 Y++L +F C FL F + +L + G F +G + Y V+ +NFS Sbjct: 172 YMILKTF--CAFLTFLLELLGVYGDGEFKWYYG--YPYIVVVLNFS 213 >At5g66610.1 68418.m08396 LIM domain-containing protein contains Pfam profile PF00412: LIM domain Length = 529 Score = 27.9 bits (59), Expect = 4.9 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +2 Query: 302 KAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSE 454 K+ D Q + +EE+ +KG+ K E+ VEN V++ + + E Sbjct: 87 KSVVDEEDQQLSKIVEESLKEKGKSKQFEDDQVENDEQQALMVQESLYMVE 137 >At5g63530.1 68418.m07974 copper chaperone (CCH)-related low similarity to copper homeostasis factor [GI:3168840]; nearly identical to farnesylated protein ATFP3 [GI:4097547]; contains Pfam profile PF00403: Heavy-metal-associated domain Length = 355 Score = 27.9 bits (59), Expect = 4.9 Identities = 17/71 (23%), Positives = 30/71 (42%) Frame = +2 Query: 221 EDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPV 400 E+ + E+ E + E+ EKK +K + G+D + K +E K K++ Sbjct: 4 EEKKPEAAEEKKMEEKKPEEKKEGEDKKVDAEKKGEDSDKKPQEGESNKDSKEDSAPAAP 63 Query: 401 ENXSTDEPSVE 433 E + P E Sbjct: 64 EAPAPPPPPQE 74 >At5g50830.1 68418.m06297 expressed protein Length = 281 Score = 27.9 bits (59), Expect = 4.9 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 6/47 (12%) Frame = +2 Query: 182 DAPKKGRGKAKVVEDP----ETESVEAEVDEKNIV--SEKKTKRGRK 304 D P + K VED ETESV E+ E + EKK +RG++ Sbjct: 197 DVPSDDDDEEKDVEDARKSMETESVTTEIKEDGSIVKKEKKERRGKR 243 >At5g13090.1 68418.m01500 expressed protein predicted proteins - Arabidopsis thaliana Length = 269 Score = 27.9 bits (59), Expect = 4.9 Identities = 30/101 (29%), Positives = 41/101 (40%), Gaps = 8/101 (7%) Frame = +2 Query: 236 ESVEAEVDEKNIVSEKKTKRG-RKAAGDTNGQDENGKIEETAPKKGRK--KNVEEPPVEN 406 E+ E E+N S K+KRG +K D + K G K K V EP E Sbjct: 129 EAFENHHGEENSASRSKSKRGKKKEKPGRRVTDSDSKPALRVTDNGDKDSKPVVEPMNET 188 Query: 407 XSTDEPSVEDEVAVSE----ENNPSED-GSETNGHIEEEQV 514 ++ V V +SE E P ++ E +G EE V Sbjct: 189 TVSESSHVSSPVRLSEAEVAEGEPEDEIVVEEDGQEEESTV 229 >At4g32650.2 68417.m04648 inward rectifying potassium channel, putative (KAT3) (AKT4) (KC1) identical to K+ inward rectifying channel protein KC1 [Arabidopsis thaliana] gi|4090537|gb|AAC98810; similar to (KAT1) K+ channel [Arabidopsis thaliana] gi|1165000|emb|CAA63601; Shaker-type channel (1P/6TM), PMID:11500563 Length = 597 Score = 27.9 bits (59), Expect = 4.9 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +2 Query: 209 AKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGK 343 A+V E ++E DE+ IV+ + + G+K G+T D NG+ Sbjct: 550 AQVQETVQSEETPQSNDEE-IVTVSRHENGQKEVGETRKHDCNGR 593 >At4g21900.1 68417.m03166 MATE efflux family protein similar to ripening regulated protein DDTFR18 [Lycopersicon esculentum] GI:12231296; contains Pfam profile PF01554: MatE Length = 1094 Score = 27.9 bits (59), Expect = 4.9 Identities = 22/93 (23%), Positives = 41/93 (44%) Frame = +2 Query: 176 DNDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEET 355 D D +G+ ++VE T + N+V K +K G ++G D +EE Sbjct: 1001 DEDGVIEGQADTRLVEFFPTPGTMMMTAQPNLVLVPKETEQQKTTGGSHGFD---LMEEE 1057 Query: 356 APKKGRKKNVEEPPVENXSTDEPSVEDEVAVSE 454 ++G K E +E + SV++ ++ +E Sbjct: 1058 PVRQGEKLPEELLHLELGNKTTLSVDNNISTTE 1090 >At3g54760.1 68416.m06059 dentin sialophosphoprotein-related contains weak similarity to Swiss-Prot:Q9NZW4 dentin sialophosphoprotein precursor (Dentin phosphophoryn DPP, Dentin sialoprotein DSP) [Homo sapiens] Length = 792 Score = 27.9 bits (59), Expect = 4.9 Identities = 19/77 (24%), Positives = 36/77 (46%), Gaps = 1/77 (1%) Frame = +2 Query: 230 ETESV-EAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVEN 406 ET SV E + D++ ++K K + D+ +DE + E+ + + E + Sbjct: 156 ETLSVAEDKADQEKETTKKIEKDINEMEVDSKQEDEENETEDAKHSESAQVPEESTKLSK 215 Query: 407 XSTDEPSVEDEVAVSEE 457 TDE + ++E V+ E Sbjct: 216 EETDEENQKEENGVAME 232 >At3g01160.1 68416.m00020 expressed protein Length = 380 Score = 27.9 bits (59), Expect = 4.9 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 5/85 (5%) Frame = +2 Query: 221 EDPETESV-EAEVDEKNIVSEKKTKRGRKAAGDTNGQDENG--KIEETAPKKGRKKN--V 385 +D ++ESV E + ++ EKK R K D + D++ I+ A K + + Sbjct: 139 KDNQSESVWETYLRQRR---EKKRARKNKQKDDDSSPDDDDDYNIDRKAVKDDGDDDFFM 195 Query: 386 EEPPVENXSTDEPSVEDEVAVSEEN 460 EEPP++ + + ++EVA E++ Sbjct: 196 EEPPLKKKKKEGKTKKEEVAAEEKS 220 >At2g34300.1 68415.m04196 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 770 Score = 27.9 bits (59), Expect = 4.9 Identities = 16/74 (21%), Positives = 30/74 (40%) Frame = +2 Query: 263 KNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEV 442 KN + +++ R K D ++ E K + + E V S ++ +E Sbjct: 61 KNDLRKEEGDRDPKNFSDEKNEENEAATENNQVKTDSENSAEGNQVNESSGEKTEAGEER 120 Query: 443 AVSEENNPSEDGSE 484 S++NN DG + Sbjct: 121 KESDDNNGDGDGEK 134 >At2g25670.2 68415.m03077 expressed protein Length = 318 Score = 27.9 bits (59), Expect = 4.9 Identities = 24/101 (23%), Positives = 45/101 (44%), Gaps = 4/101 (3%) Frame = +2 Query: 191 KKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKI----EETA 358 KK R K ++ E + ++N E+ + G++ D NG+ E + E A Sbjct: 160 KKERKKKELAELEALLADFGVAPKENNGLEESQEAGQEKKEDVNGEGEKKENAAGGESKA 219 Query: 359 PKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGS 481 KK +KK+ ++ E+ + D V + + P+E+ S Sbjct: 220 SKKKKKKDKQKEVKESQEQQANNNADAVDEAAGSEPTEEES 260 >At2g25670.1 68415.m03076 expressed protein Length = 318 Score = 27.9 bits (59), Expect = 4.9 Identities = 24/101 (23%), Positives = 45/101 (44%), Gaps = 4/101 (3%) Frame = +2 Query: 191 KKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKI----EETA 358 KK R K ++ E + ++N E+ + G++ D NG+ E + E A Sbjct: 160 KKERKKKELAELEALLADFGVAPKENNGLEESQEAGQEKKEDVNGEGEKKENAAGGESKA 219 Query: 359 PKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGS 481 KK +KK+ ++ E+ + D V + + P+E+ S Sbjct: 220 SKKKKKKDKQKEVKESQEQQANNNADAVDEAAGSEPTEEES 260 >At1g76780.1 68414.m08935 expressed protein ; expression supported by MPSS Length = 1871 Score = 27.9 bits (59), Expect = 4.9 Identities = 24/97 (24%), Positives = 39/97 (40%), Gaps = 2/97 (2%) Frame = +2 Query: 191 KKGRGKAKVVE--DPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPK 364 K+ GK K+ + ET +EK + + KK G Q+ + E P Sbjct: 498 KRSEGKHKIQKTFQEETNKQPEGYNEKIMETGKKINED----GTRKVQEMIRQQELDEPA 553 Query: 365 KGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSED 475 + K+N V++ + DE E E+A +E D Sbjct: 554 RSEKENRSRELVKSKTNDEEKKEKEIAGTERKEKESD 590 >At1g09210.1 68414.m01028 calreticulin 2 (CRT2) identical to SP|Q38858 Calreticulin 2 precursor {Arabidopsis thaliana} Length = 424 Score = 27.9 bits (59), Expect = 4.9 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 2/73 (2%) Frame = +2 Query: 299 RKAAGDTNGQ--DENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSE 472 +K A +T G+ D + A KK ++ ++ P E+ + DEP +DE +++ SE Sbjct: 344 KKLADETWGKLKDAEKAAFDEAEKKNEEEESKDAPAESDAEDEPE-DDE---GGDDSDSE 399 Query: 473 DGSETNGHIEEEQ 511 +E ++ E+ Sbjct: 400 SKAEETKSVDSEE 412 >At5g55920.1 68418.m06975 nucleolar protein, putative similar to SP|P46087 Proliferating-cell nucleolar antigen p120 (Proliferation-associated nucleolar protein p120) {Homo sapiens}, SP|P40991 Nucleolar protein NOP2 {Saccharomyces cerevisiae}; contains Pfam profile PF01189: NOL1/NOP2/sun family Length = 682 Score = 27.5 bits (58), Expect = 6.4 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = +2 Query: 362 KKGRKKNVEEPPVENXS-TDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVPSG 523 KK +K+ VEE P+E+ TD+ +DEV+ + + E+ E + +G Sbjct: 51 KKQKKEVVEEEPLEDYEVTDDSDEDDEVSDGSDEDDISPAVESEEIDESDDGENG 105 >At5g48610.1 68418.m06012 expressed protein ; expression supported by MPSS Length = 470 Score = 27.5 bits (58), Expect = 6.4 Identities = 26/112 (23%), Positives = 43/112 (38%), Gaps = 3/112 (2%) Frame = +2 Query: 176 DNDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTK---RGRKAAGDTNGQDENGKI 346 D KK + + E E +S + D++ EKK K + K G G+ K Sbjct: 13 DKYKEKKHKKDKEKREGKEKKSKDRSKDKQKERKEKKDKHKDQKDKEKGKEKGKPLEEKK 72 Query: 347 EETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIE 502 E G ++N V+N S E ++A + GS++ I+ Sbjct: 73 AELLTNAGHRENRVTDTVQNNSNGESKYVQDLARRIRYDEEATGSQSAQRID 124 >At5g23420.1 68418.m02747 high mobility group (HMG1/2) family protein similar to high mobility group protein 2 HMG2 [Ipomoea nil] GI:1052956; contains Pfam profile PF00505: HMG (high mobility group) box Length = 241 Score = 27.5 bits (58), Expect = 6.4 Identities = 19/83 (22%), Positives = 34/83 (40%) Frame = +2 Query: 263 KNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEV 442 K++ E+K KAA + + A ++ + + V++ + +DEV Sbjct: 154 KSLTEEEKKVYLDKAA-ELKAEYNKSLESNDADEEEEDEEKQSDDVDDAEEKQVDDDDEV 212 Query: 443 AVSEENNPSEDGSETNGHIEEEQ 511 E N +D E G EEE+ Sbjct: 213 EEKEVENTDDDKKEAEGKEEEEE 235 >At4g37490.1 68417.m05305 G2/mitotic-specific cyclin (CYC1) / B-like cyclin (CYC1) identical to SP|P30183 G2/mitotic-specific cyclin (B-like cyclin) {Arabidopsis thaliana} Length = 428 Score = 27.5 bits (58), Expect = 6.4 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 2/85 (2%) Frame = +2 Query: 188 PKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKK 367 PKK GK KVV+ E S +++ + + + +K +KA T+ K KK Sbjct: 85 PKKVAGKPKVVDVIEISS-DSDEELGLVAAREKKATKKKATTYTSVLTARSKAACGLEKK 143 Query: 368 GRKK--NVEEPPVENXSTDEPSVED 436 ++K +++ VEN VED Sbjct: 144 QKEKIVDIDSADVENDLAAVEYVED 168 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 27.5 bits (58), Expect = 6.4 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +2 Query: 413 TDEPSVEDEV--AVSEENNPSEDGSETNGHIEEEQ 511 T+ S +DE+ +V EE E+G E +EEE+ Sbjct: 72 TEASSADDEIQASVEEEEEVEEEGDEGEEEVEEEK 106 >At3g27600.1 68416.m03448 hypothetical protein Length = 313 Score = 27.5 bits (58), Expect = 6.4 Identities = 10/39 (25%), Positives = 23/39 (58%) Frame = +2 Query: 368 GRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSE 484 GR+ N+ E V++ S + S ++++A + NP+ + + Sbjct: 223 GRELNIIEKTVQSLSENVASFKEKIAADKPKNPTREAGD 261 >At3g23090.1 68416.m02911 expressed protein Length = 338 Score = 27.5 bits (58), Expect = 6.4 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = +2 Query: 374 KKNVEEPPVENXSTDEPSVEDEVAVSEEN 460 ++NV EP +++ S D+ +V E+ EEN Sbjct: 25 QENVSEPLLDSVSRDDANVHTELRYGEEN 53 >At3g14670.1 68416.m01856 hypothetical protein Length = 232 Score = 27.5 bits (58), Expect = 6.4 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +2 Query: 383 VEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQVPSG 523 VEE + + +E S +DE SEE E+ E EEE+ G Sbjct: 68 VEEGEKSDNNEEENSEKDEKEESEEEESEEEEKEEEEKEEEEKEEEG 114 >At2g33080.1 68415.m04056 leucine-rich repeat family protein contains leucine rich-repeat domain Pfam:PF00560, INTERPRO:IPR001611; contains similarity to Cf-2.2 [Lycopersicon pimpinellifolium] gi|1184077|gb|AAC15780 Length = 740 Score = 27.5 bits (58), Expect = 6.4 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = -3 Query: 370 SFFWCCFLYFTILILSICVTGSFPSAFGFLFRYNVLFINFSFY 242 S FW L F L + + SFPS FG L + VL ++F+ + Sbjct: 95 SLFWFHQLRFLNLSHNNFTSTSFPSEFGNLNKVEVLDLSFNSF 137 >At2g19520.1 68415.m02281 WD-40 repeat protein (MSI4) contains 6 (4 significant) WD-40 repeats (PF0400); identical to WD-40 repeat protein MSI4 (SP:O22607) [Arabidopsis thaliana] Length = 507 Score = 27.5 bits (58), Expect = 6.4 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 Query: 188 PKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKR 295 PKK K K ED +T S + + D K S KKT++ Sbjct: 25 PKKRGRKPKTKEDSQTPSSQQQSDVKMKESGKKTQQ 60 >At2g17240.1 68415.m01991 expressed protein Length = 140 Score = 27.5 bits (58), Expect = 6.4 Identities = 14/49 (28%), Positives = 21/49 (42%) Frame = +2 Query: 338 GKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSE 484 G+ + PK K PP+ +E E+E EE NP ++ E Sbjct: 86 GRRPDIFPKFSPMKTPLPPPMPYDPPEEDEEEEEKKEEEEENPDQEEEE 134 >At2g12400.1 68415.m01339 expressed protein Length = 541 Score = 27.5 bits (58), Expect = 6.4 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = -3 Query: 391 FLYILLPSFFWCCFLYFTILILSICVTGSFPSAFGFLFRYNVL 263 F+ LL F C +Y +++ I VT +F GFL +NV+ Sbjct: 269 FIGFLLSIFGLQCLVYTLVILGWILVTVTFVLCGGFLLLHNVV 311 >At1g76820.1 68414.m08939 expressed protein Length = 266 Score = 27.5 bits (58), Expect = 6.4 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +2 Query: 332 ENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNP 466 E K+ T KKG+K+N + + D+ D+ AV EE P Sbjct: 48 EENKVVITGKKKGKKRN--KKGTQQQQDDDDDFADKFAVEEEVVP 90 >At1g68920.1 68414.m07887 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 486 Score = 27.5 bits (58), Expect = 6.4 Identities = 20/77 (25%), Positives = 32/77 (41%) Frame = +2 Query: 254 VDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVE 433 V E S ++GR+ + +T + NG+ A + R + EE P N DE Sbjct: 214 VSEDTQSSGGNGQKGRETSSNTKKRKRNGQKNSEAAQSHRSQQSEEEPDNNG--DEKR-N 270 Query: 434 DEVAVSEENNPSEDGSE 484 DE + + S G + Sbjct: 271 DEQSPNSPGKKSNSGKQ 287 >At1g30280.1 68414.m03703 expressed protein contains low similarity to cyclin G-associated kinase GI:1902912 SP|P97874 from [Rattus norvegicus] Length = 455 Score = 27.5 bits (58), Expect = 6.4 Identities = 22/79 (27%), Positives = 30/79 (37%) Frame = +2 Query: 221 EDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPV 400 ED E E + + V E N S++ + + G D N E A K R + E Sbjct: 275 EDEEEEEMSSYVIEIN--SDRFDRYREEGGGGGGNSDSNDMDEAIAWAKERSQRPEAKQT 332 Query: 401 ENXSTDEPSVEDEVAVSEE 457 E D E+E EE Sbjct: 333 EEDVIDSRRSEEEPKSEEE 351 >At1g15280.2 68414.m01829 glycine-rich protein Length = 585 Score = 27.5 bits (58), Expect = 6.4 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 176 DNDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGR-KAAGDTNGQDENGK 343 D+D + G K D + E + +E++ K G K AGD NG++EN K Sbjct: 48 DSDLSDEEVGTVKYDNDEDGEDSYEDDEEESGGGIDNDKSGVVKEAGDMNGEEENEK 104 >At1g15280.1 68414.m01828 glycine-rich protein Length = 584 Score = 27.5 bits (58), Expect = 6.4 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +2 Query: 176 DNDAPKKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGR-KAAGDTNGQDENGK 343 D+D + G K D + E + +E++ K G K AGD NG++EN K Sbjct: 48 DSDLSDEEVGTVKYDNDEDGEDSYEDDEEESGGGIDNDKSGVVKEAGDMNGEEENEK 104 >At1g01490.1 68414.m00065 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 177 Score = 27.5 bits (58), Expect = 6.4 Identities = 17/66 (25%), Positives = 25/66 (37%) Frame = +2 Query: 251 EVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSV 430 E +++ KK G + E GK E APKK +K E D+P Sbjct: 73 EPEKEKKEEPKKEGGGEPPKKEGEAPKEEGKKEGEAPKKEEEKKEGGDKKEGEKKDQPQA 132 Query: 431 EDEVAV 448 + + V Sbjct: 133 QPQPVV 138 >At5g57160.1 68418.m07140 DNA ligase IV identical to DNA ligase IV GI:9651815 from [Arabidopsis thaliana]; identical to cDNA DNA ligase IV, GI:9651814 Length = 1219 Score = 27.1 bits (57), Expect = 8.5 Identities = 17/76 (22%), Positives = 38/76 (50%) Frame = +2 Query: 221 EDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPV 400 + P E ++ + + + S T + +K + T +N K+ +++ K+G KKNV P Sbjct: 584 DKPWHECLDVQAFVELVNSSNGTTQKQKESESTQ---DNPKVNKSS-KRGEKKNVSLVPS 639 Query: 401 ENXSTDEPSVEDEVAV 448 + TD ++ + ++ Sbjct: 640 QFIQTDVSDIKGKTSI 655 >At5g40450.1 68418.m04905 expressed protein Length = 2910 Score = 27.1 bits (57), Expect = 8.5 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 5/54 (9%) Frame = +2 Query: 341 KIEETAPKKGRKKNVE--EPPVENXSTDEPSVEDEVAVSEENNPSED---GSET 487 K+ ET PK+ + + E + VE+ ST + V EVA E + P+E+ G ET Sbjct: 2156 KVGETKPKESQAEGAEKSDDQVEDESTKKTDV--EVAGLENDYPTEEAEHGDET 2207 >At5g10490.1 68418.m01215 mechanosensitive ion channel domain-containing protein / MS ion channel domain-containing protein contains Pfam profile PF00924: Mechanosensitive ion channel Length = 519 Score = 27.1 bits (57), Expect = 8.5 Identities = 25/90 (27%), Positives = 38/90 (42%), Gaps = 5/90 (5%) Frame = +2 Query: 269 IVSEKKTKRGRKAAGDTNGQDENG---KIEETAPK--KGRKKNVEEPPVENXSTDEPSVE 433 I E K+K +AA T Q+ G K +ET+ K K E P + E +V Sbjct: 339 INGEDKSKSQNRAAKPTAEQENKGSNPKSKETSSPDLKANVKVGESPVSDTNKVPEETVA 398 Query: 434 DEVAVSEENNPSEDGSETNGHIEEEQVPSG 523 V + P+ +ET+G + + SG Sbjct: 399 KPVIKAVSKPPTPKDTETSGTEKPKAKRSG 428 >At4g39550.1 68417.m05592 kelch repeat-containing F-box family protein similar to SKP1 interacting partner 6 [Arabidopsis thaliana] GI:10716957; contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 392 Score = 27.1 bits (57), Expect = 8.5 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +2 Query: 353 TAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVS 451 ++P+K RK + P +T PS+ D++ VS Sbjct: 2 SSPEKKRKTTKKPSPTPQSTTPNPSLPDDLVVS 34 >At4g26600.1 68417.m03834 nucleolar protein, putative similar to SP|P46087 Proliferating-cell nucleolar antigen p120 (Proliferation-associated nucleolar protein p120) {Homo sapiens}; contains Pfam profile PF01189: NOL1/NOP2/sun family Length = 671 Score = 27.1 bits (57), Expect = 8.5 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = +2 Query: 341 KIEETAPKKGRKKNVEEPPVENX--STDEPSVEDEVAVSEENNPSEDGSETNGHIEEE 508 K ++ KK RK E+ P++ STDE E+E S+E SE GS+ +EE Sbjct: 33 KTQKPPLKKQRKCISEKKPLKKPEVSTDEEEEEEENEQSDEG--SESGSDLFSDGDEE 88 >At3g57930.1 68416.m06457 expressed protein Length = 141 Score = 27.1 bits (57), Expect = 8.5 Identities = 14/66 (21%), Positives = 30/66 (45%) Frame = +2 Query: 293 RGRKAAGDTNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSE 472 RG+ + +++ G EE RK+ + PV++ +E + + E+ + Sbjct: 5 RGKGKRQNATAREDRGSGEEEKIPAFRKRGRPQKPVKDEEEEEEELVKKTDEEEDKDDDT 64 Query: 473 DGSETN 490 +GS T+ Sbjct: 65 NGSVTS 70 >At3g55020.1 68416.m06110 RabGAP/TBC domain-containing protein low similarity to SP|Q9BXI6 EBP50-PDZ interactor of 64 kDa (EPI64 protein) {Homo sapiens}; contains Pfam profile PF00566: TBC domain Length = 777 Score = 27.1 bits (57), Expect = 8.5 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Frame = +2 Query: 317 TNGQDENGKIEETAPKKGRKKNVEEPPVENXSTDE--PSVEDEVAVSEENNPSED 475 TNG EN + +K ++K + + P E+ TD+ V + A EE +P + Sbjct: 76 TNGSSENIHAPFSESEKEKEKELNKGPGEDLHTDKLGSDVTPDNASEEEGHPDAE 130 >At3g52140.1 68416.m05723 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515: TPR Domain Length = 1403 Score = 27.1 bits (57), Expect = 8.5 Identities = 14/54 (25%), Positives = 22/54 (40%) Frame = +2 Query: 200 RGKAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAP 361 +G V P ++ ++ + SEK + G + ENGK E AP Sbjct: 1331 QGGVPVQAMPPLSQLQNMINTATVSSEKGGENGEAKVQEKKESSENGKTENLAP 1384 >At3g50370.1 68416.m05508 expressed protein Length = 2179 Score = 27.1 bits (57), Expect = 8.5 Identities = 24/110 (21%), Positives = 48/110 (43%), Gaps = 3/110 (2%) Frame = +2 Query: 191 KKGRGKAKVVEDPETESVEAEVDEKNIVSEKKTKR---GRKAAGDTNGQDENGKIEETAP 361 KK K DP ES EAE++ + E++ +R ++ + +E ++ Sbjct: 452 KKEALKQTEFHDPVRESFEAELERVQKMQEEERRRIIEEQERVIELARTEEEERLRLARE 511 Query: 362 KKGRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEEEQ 511 + R++ +EE E +E + +EE S++ + +EEE+ Sbjct: 512 QDERQRRLEEEAREAAFRNEQERLEATRRAEELRKSKEEEKHRLFMEEER 561 >At3g48060.1 68416.m05240 bromo-adjacent homology (BAH) domain-containing protein contains Pfam profile PF01426: BAH domain Length = 1611 Score = 27.1 bits (57), Expect = 8.5 Identities = 26/100 (26%), Positives = 43/100 (43%), Gaps = 5/100 (5%) Frame = +2 Query: 206 KAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAG--DTNGQDENGKIEET---APKKG 370 KA+ + D + VEAE+D K+ ++ + GR + G + G E K + A K Sbjct: 397 KARSLVDTWKKRVEAEMDAKSGSNQGVSWPGRLSHGGRHSGGSAEANKTSSSHLHASKSV 456 Query: 371 RKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETN 490 K E ++ +T S + N S+DG + N Sbjct: 457 SVKQQVENNLKCVATSPGSTRSAPSPGSGGNVSKDGQQRN 496 >At3g48050.2 68416.m05239 bromo-adjacent homology (BAH) domain-containing protein contains Pfam profile PF01426: BAH domain Length = 1613 Score = 27.1 bits (57), Expect = 8.5 Identities = 26/100 (26%), Positives = 43/100 (43%), Gaps = 5/100 (5%) Frame = +2 Query: 206 KAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAG--DTNGQDENGKIEET---APKKG 370 KA+ + D + VEAE+D K+ ++ + GR + G + G E K + A K Sbjct: 397 KARSLVDTWKKRVEAEMDAKSGSNQGVSWPGRLSHGGRHSGGSAEANKTSSSHLHASKSV 456 Query: 371 RKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETN 490 K E ++ +T S + N S+DG + N Sbjct: 457 SVKQQVENNLKCVATSPGSTRSAPSPGSGGNVSKDGQQRN 496 >At3g48050.1 68416.m05238 bromo-adjacent homology (BAH) domain-containing protein contains Pfam profile PF01426: BAH domain Length = 1613 Score = 27.1 bits (57), Expect = 8.5 Identities = 26/100 (26%), Positives = 43/100 (43%), Gaps = 5/100 (5%) Frame = +2 Query: 206 KAKVVEDPETESVEAEVDEKNIVSEKKTKRGRKAAG--DTNGQDENGKIEET---APKKG 370 KA+ + D + VEAE+D K+ ++ + GR + G + G E K + A K Sbjct: 397 KARSLVDTWKKRVEAEMDAKSGSNQGVSWPGRLSHGGRHSGGSAEANKTSSSHLHASKSV 456 Query: 371 RKKNVEEPPVENXSTDEPSVEDEVAVSEENNPSEDGSETN 490 K E ++ +T S + N S+DG + N Sbjct: 457 SVKQQVENNLKCVATSPGSTRSAPSPGSGGNVSKDGQQRN 496 >At3g45230.1 68416.m04881 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420 Length = 175 Score = 27.1 bits (57), Expect = 8.5 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +2 Query: 344 IEETAPKK-GRKKNVEEPPVENXSTDEPSVEDEVAVSEENNPS 469 I + P K G + E P+E S EP E + S N+PS Sbjct: 39 IHASPPSKLGSHNSPAESPIEYSSPPEPETEHSPSPSPANSPS 81 >At3g13700.1 68416.m01731 RNA-binding protein, putative similar to mec-8 [Caenorhabditis elegans] GI:1370048; contains Pfam profile:PF00076 rrm:RNA recognition motif Length = 296 Score = 27.1 bits (57), Expect = 8.5 Identities = 23/97 (23%), Positives = 39/97 (40%), Gaps = 3/97 (3%) Frame = +2 Query: 224 DPETES-VEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGKIEETAPKKGRKK--NVEEP 394 DP+T S + E+ N +++ G D N E K ++ +G V+EP Sbjct: 120 DPQTGSNLHIELARSNSRRKERPGSGPYVVID-NRNKEISKSQDDQSDEGDSDPDEVQEP 178 Query: 395 PVENXSTDEPSVEDEVAVSEENNPSEDGSETNGHIEE 505 ++D P D ++ P NGH+E+ Sbjct: 179 ----GNSDSPKENDTTKSEADSEPDSKAPSANGHLEK 211 >At2g38910.1 68415.m04783 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase, isoform AK1 (CDPK) [Arabidopsis thaliana] SWISS-PROT:Q06850; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 583 Score = 27.1 bits (57), Expect = 8.5 Identities = 20/80 (25%), Positives = 31/80 (38%), Gaps = 3/80 (3%) Frame = +2 Query: 260 EKNIVSEKKTKRGRKAAGDTNGQDENGKIEET---APKKGRKKNVEEPPVENXSTDEPSV 430 + +I S K +K NG D NG + T AP + PPV+ + +EP Sbjct: 30 DDSIKSSKDESSRKKNDKSVNGDDSNGHVSSTVDPAPSTLPTPSTPPPPVK-MANEEPPP 88 Query: 431 EDEVAVSEENNPSEDGSETN 490 + E+ N E + Sbjct: 89 KPITENKEDPNSKPQKKEAH 108 >At1g76720.1 68414.m08929 eukaryotic translation initiation factor 2 family protein / eIF-2 family protein similar to SP|O60841 Translation initiation factor IF-2 {Homo sapiens}; contains Pfam profiles PF00009: Elongation factor Tu GTP binding domain, PF03144: Elongation factor Tu domain 2 Length = 1201 Score = 27.1 bits (57), Expect = 8.5 Identities = 25/103 (24%), Positives = 44/103 (42%), Gaps = 7/103 (6%) Frame = +2 Query: 230 ETESVEAEVDEKNIVSEKKTKRGRKAAGDTNGQDENGK--IEETAPKKGRKKNVEEPPVE 403 ET + E V + + + G A + G+ E K +E A KK +KK ++ + Sbjct: 263 ETPAAERPASSTPEVEKVQAQPGPVAPVENAGEKEGEKETVETAAAKKKKKKKEKDKEKK 322 Query: 404 NXSTDEPSVE-----DEVAVSEENNPSEDGSETNGHIEEEQVP 517 + SVE E +V+E P + + G E+++P Sbjct: 323 AAAAATSSVEAKEEKQEESVTEPLQPKK--KDAKGKAAEKKIP 363 >At1g43100.1 68414.m04965 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to SP|P35339 Exopolygalacturonase precursor (EC 3.2.1.67) (Pectinase) (Galacturan 1,4-alpha-galacturonidase) {Zea mays}; contains Pfam profile PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 444 Score = 27.1 bits (57), Expect = 8.5 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 418 ISRXIFHRRFLYILLPSFFWCCFLYFTILILSI 320 I+ + H F YILLP+F C + F +L+ I Sbjct: 413 ITFWVIHDIFSYILLPNF--CIYFMFYVLVYMI 443 >At1g43090.1 68414.m04964 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to SP|P35339 Exopolygalacturonase precursor (EC 3.2.1.67) (Pectinase) (Galacturan 1,4-alpha-galacturonidase) {Zea mays}; contains Pfam profile PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 444 Score = 27.1 bits (57), Expect = 8.5 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 418 ISRXIFHRRFLYILLPSFFWCCFLYFTILILSI 320 I+ + H F YILLP+F C + F +L+ I Sbjct: 413 ITFWVIHDIFSYILLPNF--CIYFMFYVLVYMI 443 >At1g26650.1 68414.m03245 expressed protein Length = 335 Score = 27.1 bits (57), Expect = 8.5 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -3 Query: 391 FLYILLPSFFWCCFLYFTILILSICVTGSFPSAFGFLFRYNV 266 F Y+ + CF +F +L+++IC SF S GF +NV Sbjct: 156 FTYVWICILIVGCFTFFCVLLVAIC--SSF-SVLGFSPDFNV 194 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,150,818 Number of Sequences: 28952 Number of extensions: 154639 Number of successful extensions: 1351 Number of sequences better than 10.0: 168 Number of HSP's better than 10.0 without gapping: 1057 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1268 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1062855648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -