BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_N24 (653 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY211494-1|AAO62941.1| 253|Homo sapiens tRNA splicing 2' phosph... 36 0.095 AC004908-3|AAD05197.1| 430|Homo sapiens WUGSC:H_DJ0855D21.3 pro... 30 8.3 >AY211494-1|AAO62941.1| 253|Homo sapiens tRNA splicing 2' phosphotransferase 1 protein. Length = 253 Score = 36.3 bits (80), Expect = 0.095 Identities = 16/22 (72%), Positives = 20/22 (90%) Frame = +2 Query: 251 KDVQLSKSLSWLLRHGAVKEGL 316 +DVQLSK+LS+ LRHGA+K GL Sbjct: 27 RDVQLSKALSYALRHGALKLGL 48 >AC004908-3|AAD05197.1| 430|Homo sapiens WUGSC:H_DJ0855D21.3 protein. Length = 430 Score = 29.9 bits (64), Expect = 8.3 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +1 Query: 73 SI*QNKCPSVFLTFTIIHYYQTKHFFCKKLDTISYIFLEFN 195 SI ++ + LT +I Y +TKHF KK I +L FN Sbjct: 41 SIGEDFTQHIALTQNVITYMRTKHFVSKKFGKIFSDWLSFN 81 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,769,139 Number of Sequences: 237096 Number of extensions: 1821148 Number of successful extensions: 2118 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2092 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2118 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7310122300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -