BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_N24 (653 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g27260.1 68415.m03276 expressed protein 29 3.6 At2g23460.1 68415.m02801 extra-large guanine nucleotide binding ... 28 4.7 At3g45040.1 68416.m04852 phosphatidate cytidylyltransferase fami... 27 8.2 >At2g27260.1 68415.m03276 expressed protein Length = 243 Score = 28.7 bits (61), Expect = 3.6 Identities = 18/48 (37%), Positives = 29/48 (60%) Frame = +2 Query: 365 IYWIYYLFILLNNKIMTIFHSIVNPQTLLLHVNHASLKIEH*FNISDH 508 ++ ++ F+LL I+ IF IV PQ L VN SL + + FN+S++ Sbjct: 62 LFIVFTTFLLLLGLILFIFFLIVRPQ--LPDVNLNSLSVSN-FNVSNN 106 >At2g23460.1 68415.m02801 extra-large guanine nucleotide binding protein / G-protein (XLG) identical to extra-large G-protein (XLG) [Arabidopsis thaliana] GI:3201680 Length = 888 Score = 28.3 bits (60), Expect = 4.7 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +2 Query: 251 KDVQLSKSLSWLLRHGAVKEGLQIR*SN*NPIV 349 +D +LS S LLR +VKE L + S+ NP+V Sbjct: 115 EDCELSSSGELLLRSCSVKESLDLNESSSNPLV 147 >At3g45040.1 68416.m04852 phosphatidate cytidylyltransferase family protein weak similarity to SP|P20048 Dolichol kinase (EC 2.7.1.108) {Saccharomyces cerevisiae}; contains Pfam profile: PF01148 phosphatidate cytidylyltransferase Length = 569 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/37 (35%), Positives = 19/37 (51%) Frame = +2 Query: 182 FWNLITACSISLSCL*VLIYRCKKDVQLSKSLSWLLR 292 +W +C L L V++ + +KD LS S WL R Sbjct: 111 YWAASASCCAILIYLSVIMSQVRKDESLSSSSIWLTR 147 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,244,347 Number of Sequences: 28952 Number of extensions: 261813 Number of successful extensions: 458 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 457 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -