BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_N21 (654 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81292-1|CAB03593.1| 209|Anopheles gambiae GSTD1-6 protein prot... 27 0.52 Z71481-1|CAA96105.1| 140|Anopheles gambiae GSTD2 protein protein. 27 0.52 AF071160-1|AAC79995.1| 209|Anopheles gambiae glutathione S-tran... 27 0.52 AF071161-1|AAC79997.1| 218|Anopheles gambiae glutathione S-tran... 25 1.6 Z81291-1|CAB03592.1| 209|Anopheles gambiae GSTD1-5 protein prot... 25 2.8 AF513635-1|AAM53607.1| 212|Anopheles gambiae glutathione S-tran... 25 2.8 AF071160-3|AAC79993.1| 209|Anopheles gambiae glutathione S-tran... 25 2.8 AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-tran... 24 4.8 AF515522-1|AAM61889.1| 222|Anopheles gambiae glutathione S-tran... 24 4.8 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 23 6.4 AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsi... 23 6.4 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 23 6.4 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 23 6.4 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 23 8.4 AF316636-1|AAG45164.1| 221|Anopheles gambiae glutathione S-tran... 23 8.4 >Z81292-1|CAB03593.1| 209|Anopheles gambiae GSTD1-6 protein protein. Length = 209 Score = 27.1 bits (57), Expect = 0.52 Identities = 12/46 (26%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +1 Query: 346 PILIDNGLAILENEKIERHIMKSVPGGHNLFVQDKEVASLI-ENLY 480 P L+DNG A+ E+ I+ ++ + L+ +D + +++ + LY Sbjct: 53 PTLVDNGFALWESRAIQIYLAEKYGKDDKLYPKDPQKRAVVNQRLY 98 >Z71481-1|CAA96105.1| 140|Anopheles gambiae GSTD2 protein protein. Length = 140 Score = 27.1 bits (57), Expect = 0.52 Identities = 12/46 (26%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +1 Query: 346 PILIDNGLAILENEKIERHIMKSVPGGHNLFVQDKEVASLI-ENLY 480 P L+DNG A+ E+ I+ ++ + L+ +D + +++ + LY Sbjct: 53 PTLVDNGFALWESRAIQIYLAEKYGKDDKLYPKDPQKRAVVNQRLY 98 >AF071160-1|AAC79995.1| 209|Anopheles gambiae glutathione S-transferase protein. Length = 209 Score = 27.1 bits (57), Expect = 0.52 Identities = 12/46 (26%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = +1 Query: 346 PILIDNGLAILENEKIERHIMKSVPGGHNLFVQDKEVASLI-ENLY 480 P L+DNG A+ E+ I+ ++ + L+ +D + +++ + LY Sbjct: 53 PTLVDNGFALWESRAIQIYLAEKYGKDDKLYPKDPQKRAVVNQRLY 98 >AF071161-1|AAC79997.1| 218|Anopheles gambiae glutathione S-transferase D7 protein. Length = 218 Score = 25.4 bits (53), Expect = 1.6 Identities = 18/79 (22%), Positives = 41/79 (51%), Gaps = 4/79 (5%) Frame = +1 Query: 247 LLAELKTISLKVTTVDM---QKPPPDFRTNFEATHP-PILIDNGLAILENEKIERHIMKS 414 LLA++ + L++ +++ ++ PDF H P L D+GL + E+ I +++ + Sbjct: 19 LLAKMIGVELELKALNVMEGEQLKPDF-VELNPQHCIPTLDDHGLVLWESRVILAYLVSA 77 Query: 415 VPGGHNLFVQDKEVASLIE 471 NL+ +D ++++ Sbjct: 78 YGKDENLYPKDFRSRAIVD 96 >Z81291-1|CAB03592.1| 209|Anopheles gambiae GSTD1-5 protein protein. Length = 209 Score = 24.6 bits (51), Expect = 2.8 Identities = 10/41 (24%), Positives = 22/41 (53%) Frame = +1 Query: 346 PILIDNGLAILENEKIERHIMKSVPGGHNLFVQDKEVASLI 468 P L+DNG A+ E+ I ++ + L+ +D + +++ Sbjct: 53 PTLVDNGFALWESRAICTYLAEKYGKDDKLYPKDPQKRAVV 93 >AF513635-1|AAM53607.1| 212|Anopheles gambiae glutathione S-transferase D4 protein. Length = 212 Score = 24.6 bits (51), Expect = 2.8 Identities = 19/88 (21%), Positives = 38/88 (43%), Gaps = 2/88 (2%) Frame = +1 Query: 211 CLFCQEYFMDLYLLAELKTISLKVTTVDMQKPPP-DFRTNFEATHP-PILIDNGLAILEN 384 C F + L+A+ I L + +++ P D + H P+L+DNG + E Sbjct: 5 CNFVSPPSQSVILVAKKLGIKLNLRKINIYDPVAMDTLSKLNPHHILPMLVDNGTVVFEP 64 Query: 385 EKIERHIMKSVPGGHNLFVQDKEVASLI 468 I ++++ L+ +D V ++ Sbjct: 65 CAIVLYLVEMYAKNDALYPKDALVRCVV 92 >AF071160-3|AAC79993.1| 209|Anopheles gambiae glutathione S-transferase protein. Length = 209 Score = 24.6 bits (51), Expect = 2.8 Identities = 10/41 (24%), Positives = 22/41 (53%) Frame = +1 Query: 346 PILIDNGLAILENEKIERHIMKSVPGGHNLFVQDKEVASLI 468 P L+DNG A+ E+ I ++ + L+ +D + +++ Sbjct: 53 PTLVDNGFALWESRAICTYLAEKYGKDDKLYPKDPQKRAVV 93 >AF515523-1|AAM61890.1| 222|Anopheles gambiae glutathione S-transferase u2 protein. Length = 222 Score = 23.8 bits (49), Expect = 4.8 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = +1 Query: 346 PILIDNGLAILENEKIERHIMKSVPGGHNLFVQDKEVASLIENL 477 P L DNG + E+ I +++ + GH L+ + +LI + Sbjct: 56 PTLDDNGFYLGESRAILSYLIDAYRPGHTLYPNIPKEKALINRV 99 >AF515522-1|AAM61889.1| 222|Anopheles gambiae glutathione S-transferase protein. Length = 222 Score = 23.8 bits (49), Expect = 4.8 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +2 Query: 554 IDGLLERRETRFLTGDTMCCFDCELMPRLQHIR 652 I+ LL +F GD + DC L+P++ + R Sbjct: 148 IEKLLSTSAGKFCVGDEITLADCCLVPQVFNAR 180 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 23.4 bits (48), Expect = 6.4 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +1 Query: 55 IEVLPGTSLLNSSVS*ITMSDEIAENGTANGDVPE 159 + LP +N + DE A +GT NG PE Sbjct: 21 MNALPRNQSVNRFQVNLVNHDEPAGHGTGNGTAPE 55 >AJ000675-1|CAA04232.1| 600|Anopheles gambiae infection responsive serine proteaselike protein protein. Length = 600 Score = 23.4 bits (48), Expect = 6.4 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = +2 Query: 299 RSRPQISAPTSKRHTRPY*SIMGWRYLRTKRSNVTS*SPCQGD 427 R P I +R RPY I+ ++ + ++ PC GD Sbjct: 490 RMEPSICREALRRVRRPYPFILDSSFVCSTTNHGDQERPCDGD 532 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 23.4 bits (48), Expect = 6.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 326 LVRKSGGGFCMSTVVTFKLI 267 LVRK GGG MS++ L+ Sbjct: 506 LVRKKGGGDAMSSIRPISLL 525 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.4 bits (48), Expect = 6.4 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +2 Query: 500 WFAKMNRNQRRYELISXRIDGLLERRETRFLTGD 601 ++ K N R++E I RID L+ L GD Sbjct: 88 YYVKPNVGVRQFEEIMERIDILIRGHPRVLLAGD 121 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 23.0 bits (47), Expect = 8.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 403 CDVRSFRSQVSPAHYRSVWAGVSLRSWCGN 314 C+ R +R S H+R++ G LR W N Sbjct: 390 CEHR-WRQMYSMIHFRNLAWGTPLRHWWDN 418 >AF316636-1|AAG45164.1| 221|Anopheles gambiae glutathione S-transferase E2 protein. Length = 221 Score = 23.0 bits (47), Expect = 8.4 Identities = 18/64 (28%), Positives = 32/64 (50%) Frame = +1 Query: 256 ELKTISLKVTTVDMQKPPPDFRTNFEATHPPILIDNGLAILENEKIERHIMKSVPGGHNL 435 EL+ ++ + T D KP + N + T P +L DNG I E+ I +++ +L Sbjct: 28 ELEQKTINLLTGDHLKPE-FVKLNPQHTIP-VLDDNGTIITESHAIMIYLVTKYGKDDSL 85 Query: 436 FVQD 447 + +D Sbjct: 86 YPKD 89 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 694,801 Number of Sequences: 2352 Number of extensions: 15608 Number of successful extensions: 108 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -