BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_N13 (634 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 25 0.81 X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 21 7.5 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 7.5 S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor prot... 21 9.9 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 21 9.9 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 21 9.9 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 24.6 bits (51), Expect = 0.81 Identities = 18/60 (30%), Positives = 24/60 (40%), Gaps = 4/60 (6%) Frame = +1 Query: 154 TNFPI-KFQPTHSEMNCGTCRSDPK---YKCPTCMVPYCSVACYKLHKQNPCIKPPSPPK 321 T PI KF+ +C C + K Y C K K+ PC +PPS P+ Sbjct: 263 TECPIGKFKHEAGSHSCEACPAHSKSSDYGFTECRCDPGYFRAEKDPKKMPCTQPPSAPQ 322 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 21.4 bits (43), Expect = 7.5 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = -3 Query: 374 VSSVGYKFSTACFTPIVCFGGDGGL 300 + +GY ++ F PI + GD L Sbjct: 178 IKKIGYNTASVAFVPISGWHGDNML 202 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.4 bits (43), Expect = 7.5 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 469 DSSANPDELVQEYMQE 516 +SS NPD+ EY+ E Sbjct: 968 ESSCNPDQKPTEYLLE 983 >S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor protein. Length = 168 Score = 21.0 bits (42), Expect = 9.9 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = -3 Query: 425 FLTSVEFSNKLSLSNGTVSSVGYKFSTACFTPIVC 321 F V+ S SL V SV Y F+P +C Sbjct: 134 FFIYVQPSATFSLDLNKVVSVFYTAVIPMFSPFIC 168 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.9 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 46 HKIYRITEINM*HLKNRLKIYYENNYK 126 HKI N + N K Y NNYK Sbjct: 79 HKIISSLSNNYNYNNNNYKKLYCNNYK 105 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 9.9 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 46 HKIYRITEINM*HLKNRLKIYYENNYK 126 HKI N + N K Y NNYK Sbjct: 79 HKIISSLSNNYNYNNNNYKKLYCNNYK 105 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,856 Number of Sequences: 438 Number of extensions: 4355 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18949215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -