BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_N09 (656 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44891| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 9e-26 SB_42688| Best HMM Match : PB1 (HMM E-Value=0.12) 34 0.12 SB_30308| Best HMM Match : B56 (HMM E-Value=9e-08) 29 3.3 SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 >SB_44891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 743 Score = 113 bits (273), Expect = 9e-26 Identities = 48/61 (78%), Positives = 56/61 (91%) Frame = +2 Query: 407 KGSLWPMTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQSDVMIVAGTLTNKMAPALR 586 + SLWP+ FGLACC +EMMH AAPRYDMDR+GVVFRASPRQ DVM+V+GT+TNKMAPALR Sbjct: 567 ESSLWPLMFGLACCGIEMMHFAAPRYDMDRFGVVFRASPRQIDVMLVSGTVTNKMAPALR 626 Query: 587 K 589 + Sbjct: 627 R 627 >SB_42688| Best HMM Match : PB1 (HMM E-Value=0.12) Length = 1338 Score = 33.9 bits (74), Expect = 0.12 Identities = 17/72 (23%), Positives = 36/72 (50%) Frame = -1 Query: 584 SKLEPFCLLKFLLQSLHQTDGEMLGILRHIGPYHSEVQQYASSLQRSKLDQRSWAKGNLS 405 ++L F L+F + GEM+ +LR PY +++ +++ K +Q+ AK + Sbjct: 641 NELHAFLKLRFHAPGIGLKQGEMVPLLRQ-SPYRDTIKEVKKRVKQEKKEQKKAAKQQAN 699 Query: 404 SPNSISHQVEPQ 369 + ++ EP+ Sbjct: 700 TMRNLERTKEPR 711 >SB_30308| Best HMM Match : B56 (HMM E-Value=9e-08) Length = 142 Score = 29.1 bits (62), Expect = 3.3 Identities = 14/33 (42%), Positives = 24/33 (72%) Frame = -1 Query: 596 RTLSSKLEPFCLLKFLLQSLHQTDGEMLGILRH 498 RTLS++L +C+++FL + TD +LG+LR+ Sbjct: 62 RTLSAQLA-YCIVQFLEKDAALTDEVILGLLRY 93 >SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1480 Score = 28.3 bits (60), Expect = 5.8 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +1 Query: 112 KNLTISCSICNREYYCCD---KICFNFQHNASYQGFGGHFS*YSAFIYEKGCLYTC 270 ++LT CSICN E D ++ + + + +GFG FS + ++ CL+ C Sbjct: 871 QSLTQPCSICNPENRLLDRRGRVSISVRKHLCSRGFGFLFSPVCSRVFT--CLFAC 924 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,049,648 Number of Sequences: 59808 Number of extensions: 422161 Number of successful extensions: 1137 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1038 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1135 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -