BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_N09 (656 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 23 3.4 EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate c... 23 3.4 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 3.4 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 22 4.5 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 21 7.8 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 21 7.8 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 21 7.8 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 21 7.8 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 21 7.8 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 21 7.8 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 22.6 bits (46), Expect = 3.4 Identities = 19/66 (28%), Positives = 27/66 (40%), Gaps = 4/66 (6%) Frame = +2 Query: 287 DTHLPAPNPTEKRPYSPFQDA---SNMAEMAVARLD-DLLNWGRKGSLWPMTFGLACCAV 454 D LP PT+K P QD + + V R++ +L G + P +V Sbjct: 233 DAILPPSRPTDKALRLPLQDVYKIGGIGTVPVGRVETGILKPGMLVTFAPAALTTEVKSV 292 Query: 455 EMMHIA 472 EM H A Sbjct: 293 EMHHEA 298 >EF051030-1|ABN05618.1| 118|Apis mellifera phosphoenolpyruvate carboxykinase protein. Length = 118 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 215 ATSPNTVLSFMKKGVFTPVVS 277 AT+PN + + K +FT V S Sbjct: 76 ATNPNAMKTIFKNTIFTNVAS 96 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.6 bits (46), Expect = 3.4 Identities = 9/28 (32%), Positives = 12/28 (42%) Frame = -2 Query: 103 YEDLCNTRNTVTYLNTNYNKGHKYAVYS 20 Y + N N N NYN +K Y+ Sbjct: 327 YNNYNNNYNNYNNYNNNYNNNYKKLYYN 354 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = -2 Query: 88 NTRNTVTYLNTNYNKGHKYAVY 23 N N Y N NYNK Y Y Sbjct: 99 NYNNKYNYNNNNYNKKLYYKNY 120 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 617 WVISMGXCANGGG 655 WV ++G CA GGG Sbjct: 3 WV-ALGRCAGGGG 14 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 617 WVISMGXCANGGG 655 WV ++G CA GGG Sbjct: 3 WV-ALGRCAGGGG 14 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 617 WVISMGXCANGGG 655 WV ++G CA GGG Sbjct: 3 WV-ALGRCAGGGG 14 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +2 Query: 617 WVISMGXCANGGG 655 WV ++G CA GGG Sbjct: 3 WV-ALGRCAGGGG 14 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 21.4 bits (43), Expect = 7.8 Identities = 19/66 (28%), Positives = 27/66 (40%), Gaps = 4/66 (6%) Frame = +2 Query: 287 DTHLPAPNPTEKRPYSPFQDA---SNMAEMAVARLD-DLLNWGRKGSLWPMTFGLACCAV 454 D LP PT+K P QD + + V R++ +L G + P +V Sbjct: 176 DAILPPTRPTDKALRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPAGLTTEVKSV 235 Query: 455 EMMHIA 472 EM H A Sbjct: 236 EMHHEA 241 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.4 bits (43), Expect = 7.8 Identities = 19/66 (28%), Positives = 27/66 (40%), Gaps = 4/66 (6%) Frame = +2 Query: 287 DTHLPAPNPTEKRPYSPFQDA---SNMAEMAVARLD-DLLNWGRKGSLWPMTFGLACCAV 454 D LP PT+K P QD + + V R++ +L G + P +V Sbjct: 233 DAILPPTRPTDKALRLPLQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPAGLTTEVKSV 292 Query: 455 EMMHIA 472 EM H A Sbjct: 293 EMHHEA 298 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,910 Number of Sequences: 438 Number of extensions: 4150 Number of successful extensions: 17 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -