BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_N08 (506 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1734.13 |atp3||F1-ATPase gamma subunit |Schizosaccharomyces ... 94 1e-20 SPAC1039.09 |isp5||amino acid permease Isp5|Schizosaccharomyces ... 28 0.92 SPBC211.03c |||guanyl-nucleotide exchange factor|Schizosaccharom... 26 3.7 SPAC15A10.16 |bud6|aip3, fat1, SPAC15E1.01|actin interacting pro... 25 4.9 SPAC1783.05 |hrp1|chd1|ATP-dependent DNA helicase Hrp1|Schizosac... 25 6.5 SPAC1039.11c ||SPAC922.02c|alpha-glucosidase|Schizosaccharomyces... 25 6.5 SPAP8A3.09c |paa1||protein phosphatase regulatory subunit Paa1|S... 25 6.5 SPCC1235.12c |mug146||meiotically upregulated gene Mug46|Schizos... 25 8.6 >SPBC1734.13 |atp3||F1-ATPase gamma subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 301 Score = 93.9 bits (223), Expect = 1e-20 Identities = 48/120 (40%), Positives = 76/120 (63%), Gaps = 1/120 (0%) Frame = +1 Query: 139 YHQPNRNMATLKAISIRLKSVKNIQKITQSMKMVSAAKYTRAERDLKAARPYGEGAVQFY 318 +H + ATLK I RLKS+KNI+KIT+++K V+ K TRA+R ++A+ Y + + + Sbjct: 24 FHASSPCEATLKEIEQRLKSIKNIEKITKTIKTVAQTKLTRAQRAMEASNKYYRVSDEVF 83 Query: 319 ERAEVTPPEDDPKQLFVAMTSDRGLCGAVHTGVSKVIRNRLSEPGA-ENIKVICVGDXSR 495 + A PE+ K L VA +SD+GLCG +H+ +S++IR L +P EN + +G+ R Sbjct: 84 KEAGTKAPEEG-KTLMVACSSDKGLCGGIHSSISRLIRRELHDPKTFENTSLCILGEKVR 142 >SPAC1039.09 |isp5||amino acid permease Isp5|Schizosaccharomyces pombe|chr 1|||Manual Length = 580 Score = 27.9 bits (59), Expect = 0.92 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 5/52 (9%) Frame = +1 Query: 337 PPEDD-PKQLFVAMTSDR----GLCGAVHTGVSKVIRNRLSEPGAENIKVIC 477 PPED P++L +T+ G+ GA+ TGV +N L E GA ++ +IC Sbjct: 70 PPEDGKPQKLKRTLTARHIQMIGIGGAIGTGVWVGSKNTLREGGAASV-LIC 120 >SPBC211.03c |||guanyl-nucleotide exchange factor|Schizosaccharomyces pombe|chr 2|||Manual Length = 1462 Score = 25.8 bits (54), Expect = 3.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +1 Query: 370 AMTSDRGLCGAVHTGVSKVIRNRLSE 447 A+ SD +C V TG+S ++RLS+ Sbjct: 191 AVLSDDSICEIVETGLSMCCQSRLSQ 216 >SPAC15A10.16 |bud6|aip3, fat1, SPAC15E1.01|actin interacting protein 3 homolog Bud6|Schizosaccharomyces pombe|chr 1|||Manual Length = 1385 Score = 25.4 bits (53), Expect = 4.9 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +1 Query: 193 KSVKNIQKITQSMKMVSAAKYTRAERDLK 279 + VKN+Q S+K +SAA +TR +K Sbjct: 958 QQVKNMQLELASLKQISAAFFTRIPLKIK 986 >SPAC1783.05 |hrp1|chd1|ATP-dependent DNA helicase Hrp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1373 Score = 25.0 bits (52), Expect = 6.5 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +1 Query: 154 RNMATLKAISIRLKSVKNIQKITQSMKMVSAAKYTRAERDL 276 +N KAI I K VKNI T ++++ RA + L Sbjct: 1071 KNKQPRKAILIEFKGVKNINAETVTLRVKDLTHLHRAYKGL 1111 >SPAC1039.11c ||SPAC922.02c|alpha-glucosidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 995 Score = 25.0 bits (52), Expect = 6.5 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 2/28 (7%) Frame = +1 Query: 343 EDDPKQLFVAMTSDRGLCGAVHT--GVS 420 + +P L VA+ SDR CG+++ GVS Sbjct: 876 KQNPYDLLVALDSDRKACGSLYVDDGVS 903 >SPAP8A3.09c |paa1||protein phosphatase regulatory subunit Paa1|Schizosaccharomyces pombe|chr 1|||Manual Length = 590 Score = 25.0 bits (52), Expect = 6.5 Identities = 15/59 (25%), Positives = 25/59 (42%) Frame = +1 Query: 79 ICKMLGRFGPGVGTQVVAVVYHQPNRNMATLKAISIRLKSVKNIQKITQSMKMVSAAKY 255 + LG F VG A V P N+A + +R K+V ++ K+ + +Y Sbjct: 69 LADQLGNFVDYVGGPEYAHVLLSPLENLAATEETVVRDKAVDSLNKVCICLSQEQLEQY 127 >SPCC1235.12c |mug146||meiotically upregulated gene Mug46|Schizosaccharomyces pombe|chr 3|||Manual Length = 311 Score = 24.6 bits (51), Expect = 8.6 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 426 HFRYTSVYSSAQTSVRGHSNKQLLGVIF 343 HF +S SS+ + R H KQLL IF Sbjct: 53 HFLSSSENSSSVRNTRTHKFKQLLHYIF 80 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,297,732 Number of Sequences: 5004 Number of extensions: 48708 Number of successful extensions: 122 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 121 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 202220600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -