BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_N08 (506 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_05_0025 + 8215685-8215716,8215859-8215937,8216340-8216412,821... 62 3e-10 07_03_0571 - 19602755-19603831 61 6e-10 12_02_1080 - 25911521-25911922 29 2.1 05_06_0223 - 26525618-26526112,26526203-26526370,26526649-265274... 29 2.1 03_06_0737 + 35879723-35879990,35880105-35880201,35880464-358805... 29 2.1 03_05_0287 + 22759946-22760836 27 6.5 03_05_0223 - 22087076-22087340,22087448-22087726,22087808-220879... 27 8.7 >10_05_0025 + 8215685-8215716,8215859-8215937,8216340-8216412, 8216712-8216864,8217456-8217569,8217649-8217776, 8219004-8219099,8219479-8219601,8219694-8219810, 8219983-8220104,8220439-8220508 Length = 368 Score = 61.7 bits (143), Expect = 3e-10 Identities = 39/111 (35%), Positives = 63/111 (56%), Gaps = 3/111 (2%) Frame = +1 Query: 172 KAISIRLKSVKNIQKITQSMKMVSAAKYTRAERDLKAARPYGEGAVQFYERAEVTPPEDD 351 +A+ R+KSV+NIQKIT++MKMV+A+K + + +R + F P D Sbjct: 60 RALRTRMKSVRNIQKITKAMKMVAASKLRAVQIRTENSRGLWQ---PFTALLGDVPSVDV 116 Query: 352 PKQLFVAMTSDRGLCGAVHT---GVSKVIRNRLSEPGAENIKVICVGDXSR 495 K + VA+TSD+GLCG +++ VSK + S P E+ K + +G+ + Sbjct: 117 KKNVIVAITSDKGLCGGINSTSVKVSKALHKLTSGPEKES-KYVILGEKGK 166 >07_03_0571 - 19602755-19603831 Length = 358 Score = 60.9 bits (141), Expect = 6e-10 Identities = 36/105 (34%), Positives = 57/105 (54%), Gaps = 11/105 (10%) Frame = +1 Query: 166 TLKAISIRLKSVKNIQKITQSMKMVSAAKYTRAERDLKAARPYGEGAVQ-FYERAEVTPP 342 +L+ + R+ SV+N QKIT++MK+V+AAK RA+ + ++RP+ E V+ Y + Sbjct: 37 SLRELRSRIDSVRNTQKITEAMKLVAAAKVRRAQEAVVSSRPFSEALVEVLYNMNQEIQT 96 Query: 343 ED----------DPKQLFVAMTSDRGLCGAVHTGVSKVIRNRLSE 447 ED K V +T +RGLCG+ + V K R+ E Sbjct: 97 EDIDLPLTRIRPVKKVALVVLTGERGLCGSFNNNVLKKAETRIEE 141 >12_02_1080 - 25911521-25911922 Length = 133 Score = 29.1 bits (62), Expect = 2.1 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -2 Query: 136 PPPRLGCPHPVRSVPTFCKFYGCLSVKFTSRRKNVAGRQ 20 P P P P S P + YGC++ RR+ + G + Sbjct: 33 PVPYCPLPSPSLSTPLHARSYGCVATAREERRRRLDGEE 71 >05_06_0223 - 26525618-26526112,26526203-26526370,26526649-26527473, 26527898-26528004,26529701-26529767 Length = 553 Score = 29.1 bits (62), Expect = 2.1 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 13/97 (13%) Frame = -3 Query: 474 DHLDVLSTRFAETVADHF---------RYTSVYSSAQTSVR---GHSNKQLLGV-IFGRC 334 D+L ++S A V D F ++ SV T++R GH +++L V I G C Sbjct: 369 DYLSLVSVLHASPVLDTFILSVQQGGMKHDSVSGDTTTNLRTMPGHKHERLKEVMIIGFC 428 Query: 333 NLSPFIELYCTFTIGTSSFQVTLSTGVFSS*HHLHGL 223 + + +EL C T+S + T++ H L + Sbjct: 429 SATSMVELTCHILENTTSLE-TITLDAVCDVHDLENI 464 >03_06_0737 + 35879723-35879990,35880105-35880201,35880464-35880591, 35880686-35880767,35880855-35880918,35880930-35881022, 35881120-35881178,35881391-35881826,35882050-35882120, 35882201-35882351 Length = 482 Score = 29.1 bits (62), Expect = 2.1 Identities = 17/45 (37%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = -1 Query: 449 GSLRRLRITLDTPVCTAPHKPLSEVIAT---NNCLGSSSGGVTSA 324 GSL+R R++ PH S I + C+GSS G TSA Sbjct: 337 GSLQRNRVSYQVDSLMLPHPDPSHAICLPSHDTCMGSSGHGSTSA 381 >03_05_0287 + 22759946-22760836 Length = 296 Score = 27.5 bits (58), Expect = 6.5 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +1 Query: 259 RAERDLKAARPYGEGAVQFYERAEVTPPEDDPKQLFVAMTSDRGL 393 R+ DLK P+ G + ERA + ++DP +FV D G+ Sbjct: 223 RSVIDLKPVLPWPIGKPKGKERACLAVVDEDPDVIFVGTEEDDGV 267 >03_05_0223 - 22087076-22087340,22087448-22087726,22087808-22087950, 22088029-22088133,22088272-22088465,22088561-22088753, 22088893-22089202,22089335-22089558,22089862-22089990, 22090019-22090078,22090426-22090617,22091463-22091522, 22091606-22091688,22092473-22092611,22092949-22093083, 22093187-22093462 Length = 928 Score = 27.1 bits (57), Expect = 8.7 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 3/66 (4%) Frame = +1 Query: 142 HQPNRNMATLKAISIRLKSVKN--IQKITQSMKMVSAAK-YTRAERDLKAARPYGEGAVQ 312 + P+R A +K + RLKS K ++++ + +SA K R +++ + A YG+ A+ Sbjct: 848 YDPDRERAQMKKMKKRLKSEKKGAMRELRKDNYFLSAVKEKERIKQEQERAEKYGK-AMA 906 Query: 313 FYERAE 330 F + E Sbjct: 907 FLQEQE 912 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,870,712 Number of Sequences: 37544 Number of extensions: 362366 Number of successful extensions: 986 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 964 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 982 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1083123860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -