BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_M16 (654 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-tran... 44 4e-06 Z71480-1|CAA96104.1| 209|Anopheles gambiae GSTD2 protein protein. 31 0.024 AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-tran... 29 0.13 AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transf... 28 0.30 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 27 0.39 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 26 1.2 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 25 2.1 AY341150-1|AAR13714.1| 164|Anopheles gambiae aminopeptidase N p... 24 3.7 AY341148-1|AAR13712.1| 164|Anopheles gambiae aminopeptidase N p... 24 3.7 CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. 23 6.4 AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. 23 6.4 AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcript... 23 6.4 AF045250-1|AAC02700.1| 259|Anopheles gambiae serine proteinase ... 23 8.4 >AF513636-1|AAM53608.1| 222|Anopheles gambiae glutathione S-transferase D6 protein. Length = 222 Score = 44.0 bits (99), Expect = 4e-06 Identities = 46/178 (25%), Positives = 82/178 (46%), Gaps = 7/178 (3%) Frame = +2 Query: 122 LIAAQYSGTDVKVAPNFVFGETNKSEDFLKKFPAGKVPAFESADGKVLLTESNAIAYYVA 301 L+ A++ ++ + V + +FLK P +P ADG V++ ES+AI Y+A Sbjct: 19 LLFAKWLKLELNLIELDVLKRDHYKPEFLKLNPQHYIPTLVDADGDVVVWESSAILIYLA 78 Query: 302 -------NESLRGGDLATQARVWQWASWSDSELLPASCAWVFPYLGIMQFNKQNVERAKS 460 +++L D+A +A+V Q + L+ + + P I+ + +E K Sbjct: 79 ERYGAADDDTLYPKDIALRAKVNQRLFYDIGTLMRSVTTYYHP---ILMGGEGKLEDFKK 135 Query: 461 DLLAALKVLDGHLLTRTFLVTERITLADVIVFSTLLHAFQHVLDPSVRSSLINVQRWF 634 + A+ VLD L + + IT+AD + T+ A +L+ S NV RW+ Sbjct: 136 -VQDAVGVLDSFLSASRWTAGDHITVADFAIAVTVA-ALDGLLNFDF-SVYPNVHRWY 190 >Z71480-1|CAA96104.1| 209|Anopheles gambiae GSTD2 protein protein. Length = 209 Score = 31.5 bits (68), Expect = 0.024 Identities = 38/160 (23%), Positives = 69/160 (43%), Gaps = 8/160 (5%) Frame = +2 Query: 188 NKSEDFLKKFPAGKVPAFESADGKVLLTESNAIAYYVANE------SLRGGDLATQARVW 349 ++S F K P +P DG ++L+ES A Y+ ++ D +A V Sbjct: 39 HRSPQFTKLNPQRTIPTL--VDGSLVLSESRAALIYLCDQYGDEDNDWYPRDTIQRAIVN 96 Query: 350 QWASWSDSELLPASCAWVFPYLGIMQFNKQNVERAKSDLLAALKVLDGHLLTRTFLVTER 529 Q + L P + P + N R + A+++L+ L F+ + Sbjct: 97 QRLFFDACVLYPRFADFYHPQVF---GNAAPDGRKRLAFEKAVELLNIFLSEHEFVAGSK 153 Query: 530 ITLADVIVFSTLLHA--FQHVLDPSVRSSLINVQRWFLTV 643 +T+AD+ +F+TL A +L P ++V RW++T+ Sbjct: 154 MTIADISLFATLATACTLGFILRP-----YVHVDRWYVTM 188 >AF316637-1|AAG45165.1| 224|Anopheles gambiae glutathione S-transferase D8 protein. Length = 224 Score = 29.1 bits (62), Expect = 0.13 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +2 Query: 473 ALKVLDGHLLTRTFLVTERITLADVIVFSTL--LHAFQHVL 589 AL VL+G+L+ + ITLAD + ST+ L QH L Sbjct: 134 ALAVLNGYLINNPYAAGPNITLADYSLVSTVTSLEVVQHDL 174 >AY255856-1|AAP13482.1| 248|Anopheles gambiae glutathione transferase o1 protein. Length = 248 Score = 27.9 bits (59), Expect = 0.30 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +2 Query: 185 TNKSEDFLKKFPAGKVPAFESADGK--VLLTESNAIAYYV 298 + K E +L+K P GKVPA E GK V L ES ++ Y+ Sbjct: 55 SEKPEWYLEKNPLGKVPALE-IPGKEGVTLYESLVLSDYI 93 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 27.5 bits (58), Expect = 0.39 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +3 Query: 324 IWLPKPVSGSGHHGLTANYCLLPALGSSLTLVSCNSTNRMLNVQ 455 + LPKP G C+L ALG L + N NR + Q Sbjct: 550 VLLPKPGKPPGESSSYRPLCMLDALGKVLERLILNRLNRHIEQQ 593 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 25.8 bits (54), Expect = 1.2 Identities = 14/41 (34%), Positives = 19/41 (46%) Frame = +3 Query: 324 IWLPKPVSGSGHHGLTANYCLLPALGSSLTLVSCNSTNRML 446 + LPKP G +G C+L ALG L + N + L Sbjct: 542 VLLPKPGKPPGSNGSYRPLCMLDALGKVLEKLILNRLHNHL 582 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 25.0 bits (52), Expect = 2.1 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -3 Query: 334 GSQISSAETFIGNVVSDGIAFS*EHLSIGTFEC 236 GSQ +AE F G + +GI + + + EC Sbjct: 88 GSQTGTAEEFAGRLAKEGIRYQMKGMVADPEEC 120 >AY341150-1|AAR13714.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 24.2 bits (50), Expect = 3.7 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +2 Query: 239 FESADGKVLLTESNAIAYYVANESLRGGDLATQARVW 349 F+S V +T SN ++ L GG + T R W Sbjct: 39 FQSGYPVVTVTLSNGELTFMQEHFLYGGSVVTSDRTW 75 >AY341148-1|AAR13712.1| 164|Anopheles gambiae aminopeptidase N protein. Length = 164 Score = 24.2 bits (50), Expect = 3.7 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +2 Query: 239 FESADGKVLLTESNAIAYYVANESLRGGDLATQARVW 349 F+S V +T SN ++ L GG + T R W Sbjct: 39 FQSGYPVVTVTLSNGELTFMQEHFLYGGSVVTSDRTW 75 >CR954256-2|CAJ14143.1| 295|Anopheles gambiae cyclin protein. Length = 295 Score = 23.4 bits (48), Expect = 6.4 Identities = 19/81 (23%), Positives = 35/81 (43%), Gaps = 2/81 (2%) Frame = -2 Query: 242 RMQALFRQETSSRSLRTCWSRQIRNS-VLLSH-QSRNIVRRSTLYKRGSFPDKCKVPRPP 69 ++ L + S++S R + +N + + H +++N R T + + PP Sbjct: 168 KLYLLLKATLSAQSFRVQKKQTKQNKKIQIKHTKTKNGCCRKTCGTGWKYRSISSLHAPP 227 Query: 68 WLEFSEREGGPRKYWRGRILP 6 + R PR WR +ILP Sbjct: 228 SHPGAHRAAEPRLDWRIKILP 248 >AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. Length = 391 Score = 23.4 bits (48), Expect = 6.4 Identities = 13/49 (26%), Positives = 20/49 (40%) Frame = -1 Query: 261 TFPSALSNAGTFPAGNFFKKSSDLLVSPNTKFGATFTSVPEYCAAINAL 115 T P+ ++ P+ S DLL+ T T PEY ++ L Sbjct: 291 TLPNIVNFIAQLPSDELRLSSIDLLLQSLTAENGTLVQDPEYVYRLSQL 339 >AB090812-2|BAC57900.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.4 bits (48), Expect = 6.4 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +3 Query: 324 IWLPKPVSGSGHHGLTANYCLLPALGSSLTLVSCN 428 + LPKP G C+L ALG L + N Sbjct: 497 VLLPKPGKAPGESSSYRPLCMLDALGKVLERLILN 531 >AF045250-1|AAC02700.1| 259|Anopheles gambiae serine proteinase protein. Length = 259 Score = 23.0 bits (47), Expect = 8.4 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 Query: 608 SLINVQRWFLTVAH 649 S+IN QRW LT AH Sbjct: 56 SIIN-QRWILTAAH 68 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 747,552 Number of Sequences: 2352 Number of extensions: 16964 Number of successful extensions: 48 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 48 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -