BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_M06 (386 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein ... 26 0.42 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 22 9.0 AY146719-1|AAO12079.1| 159|Anopheles gambiae odorant-binding pr... 22 9.0 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 22 9.0 AF437885-1|AAL84180.1| 157|Anopheles gambiae odorant binding pr... 22 9.0 >AY263177-1|AAP78792.1| 699|Anopheles gambiae TmcC-like protein protein. Length = 699 Score = 26.2 bits (55), Expect = 0.42 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Frame = -2 Query: 358 SENDPRFLNLHHXSFT---GGDTQDLGWHADWALYTQLLFLGSID*VST 221 +E +P F H SF+ G T + W + W++++ G+I ST Sbjct: 175 AELEPNFTPSHPVSFSEGIGNRTLYMSWPSSWSVFSSASQRGAISFAST 223 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 21.8 bits (44), Expect = 9.0 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +1 Query: 139 ETPGRGLPYPPHQDHSYFSQCALAR 213 E PG +P PH SY S + + Sbjct: 360 EMPGMSVPPQPHTHPSYGSPAEIPK 384 >AY146719-1|AAO12079.1| 159|Anopheles gambiae odorant-binding protein AgamOBP2 protein. Length = 159 Score = 21.8 bits (44), Expect = 9.0 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +1 Query: 106 GSRCSVRQRHRETPGRGLPYPP 171 G+ CS R P R YPP Sbjct: 22 GANCSTITTQRPAPRRDGQYPP 43 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 21.8 bits (44), Expect = 9.0 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +2 Query: 128 KDIEKPQAEVSPIHRIRITLTSRNVRSLEK 217 KD+EKP+ E + TLT + ++K Sbjct: 284 KDLEKPKTEAVEYLKQENTLTRTRNQQIQK 313 >AF437885-1|AAL84180.1| 157|Anopheles gambiae odorant binding protein protein. Length = 157 Score = 21.8 bits (44), Expect = 9.0 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +1 Query: 106 GSRCSVRQRHRETPGRGLPYPP 171 G+ CS R P R YPP Sbjct: 22 GADCSTTTTQRPAPRRDGQYPP 43 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 404,456 Number of Sequences: 2352 Number of extensions: 8445 Number of successful extensions: 15 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29929410 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -