BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_M06 (386 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL132876-13|CAD21665.1| 117|Caenorhabditis elegans Hypothetical... 66 1e-11 AF003135-8|AAK18984.1| 235|Caenorhabditis elegans Hypothetical ... 28 2.0 AF003136-7|ABE73336.1| 1539|Caenorhabditis elegans Hypothetical ... 28 2.6 AF125964-1|AAD14753.1| 471|Caenorhabditis elegans Hypothetical ... 27 3.5 U40798-6|AAA81476.1| 1003|Caenorhabditis elegans Temporarily ass... 27 4.6 AF038609-2|AAK29794.1| 226|Caenorhabditis elegans Hypothetical ... 27 4.6 AF038609-1|AAO61425.1| 234|Caenorhabditis elegans Hypothetical ... 27 4.6 AL110477-13|CAB54337.2| 789|Caenorhabditis elegans Hypothetical... 27 6.1 AF230279-1|AAG16654.1| 789|Caenorhabditis elegans SWI3-like pro... 27 6.1 Z29095-2|CAD18875.1| 2056|Caenorhabditis elegans Hypothetical pr... 26 8.1 Z29095-1|CAA82353.2| 2045|Caenorhabditis elegans Hypothetical pr... 26 8.1 >AL132876-13|CAD21665.1| 117|Caenorhabditis elegans Hypothetical protein Y105E8A.16 protein. Length = 117 Score = 65.7 bits (153), Expect = 1e-11 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +2 Query: 167 HRIRITLTSRNVRSLEKVCADLINGAKKQKLRVKGPVRMP 286 HRIR+TLTS+NV+ LEKVCA LI+GAK + L VKGP+RMP Sbjct: 17 HRIRLTLTSQNVKPLEKVCAQLIDGAKNEHLIVKGPIRMP 56 Score = 39.1 bits (87), Expect = 0.001 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +1 Query: 322 CGEGSKTWDRFQMRI 366 CGEGSKTWDRFQMRI Sbjct: 69 CGEGSKTWDRFQMRI 83 >AF003135-8|AAK18984.1| 235|Caenorhabditis elegans Hypothetical protein W03F11.1 protein. Length = 235 Score = 28.3 bits (60), Expect = 2.0 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +1 Query: 127 QRHRETPGRGLPYPPHQDHSYFSQCA 204 Q HR PG +PYP DH+ F +C+ Sbjct: 84 QGHRCYPGTRIPYP--HDHTMFLECS 107 >AF003136-7|ABE73336.1| 1539|Caenorhabditis elegans Hypothetical protein F28B3.1 protein. Length = 1539 Score = 27.9 bits (59), Expect = 2.6 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +2 Query: 140 KPQAEVSPIHRIRITLTSRNVRSLEKVCADLINGAKK 250 + +A+ SP HRI +TS+N C+ L+ A++ Sbjct: 943 RSRAQSSPDHRILTLVTSKNAEQDTATCSTLLKRAER 979 >AF125964-1|AAD14753.1| 471|Caenorhabditis elegans Hypothetical protein W03G1.5 protein. Length = 471 Score = 27.5 bits (58), Expect = 3.5 Identities = 12/37 (32%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 85 PEFNKQHGSRCSVRQRHRETPGRGL-PYPPHQDHSYF 192 P + H R R H G P+PPH H +F Sbjct: 399 PPHHHHHDGRSPSRHGHHHHHHHGCRPFPPHHGHHHF 435 >U40798-6|AAA81476.1| 1003|Caenorhabditis elegans Temporarily assigned gene nameprotein 158 protein. Length = 1003 Score = 27.1 bits (57), Expect = 4.6 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -3 Query: 207 ERTL-REVRVILMRWIGETSAWGFSMSLPDTTA 112 ERTL E R ++MR + + S G S+SLP A Sbjct: 838 ERTLLMEERTMMMRDLQKVSGGGMSLSLPPANA 870 >AF038609-2|AAK29794.1| 226|Caenorhabditis elegans Hypothetical protein C54E4.2a protein. Length = 226 Score = 27.1 bits (57), Expect = 4.6 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +2 Query: 104 MAAAVVSGKDIEKPQAEVSPIH 169 ++AA +S +D+EKP + P+H Sbjct: 14 ISAAYISSEDLEKPSSADKPVH 35 >AF038609-1|AAO61425.1| 234|Caenorhabditis elegans Hypothetical protein C54E4.2b protein. Length = 234 Score = 27.1 bits (57), Expect = 4.6 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +2 Query: 104 MAAAVVSGKDIEKPQAEVSPIH 169 ++AA +S +D+EKP + P+H Sbjct: 14 ISAAYISSEDLEKPSSADKPVH 35 >AL110477-13|CAB54337.2| 789|Caenorhabditis elegans Hypothetical protein Y113G7B.23 protein. Length = 789 Score = 26.6 bits (56), Expect = 6.1 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 85 PEFNKQHGSRCSVRQRHRETPGRGL-PYPPHQDHSYF 192 P+ +QH ++ + Q H PG G P PP Q Y+ Sbjct: 654 PQQQQQHQAQQAQSQAHYGPPGGGQGPPPPPQGQQYY 690 >AF230279-1|AAG16654.1| 789|Caenorhabditis elegans SWI3-like protein protein. Length = 789 Score = 26.6 bits (56), Expect = 6.1 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +1 Query: 85 PEFNKQHGSRCSVRQRHRETPGRGL-PYPPHQDHSYF 192 P+ +QH ++ + Q H PG G P PP Q Y+ Sbjct: 654 PQQQQQHQAQQAQSQAHYGPPGGGQGPPPPPQGQQYY 690 >Z29095-2|CAD18875.1| 2056|Caenorhabditis elegans Hypothetical protein R10E11.1b protein. Length = 2056 Score = 26.2 bits (55), Expect = 8.1 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = +1 Query: 163 YPPHQDHSYFSQCALAREGLC*PNQWSQETEAACKGPSPHANQDPAYHHP 312 YPP Q ++ F++ + G PN S + GPSP Q P P Sbjct: 120 YPPGQQNA-FNRSPMMPNGT--PNMMSPPSMGRVPGPSPGGPQPPGPGQP 166 >Z29095-1|CAA82353.2| 2045|Caenorhabditis elegans Hypothetical protein R10E11.1a protein. Length = 2045 Score = 26.2 bits (55), Expect = 8.1 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = +1 Query: 163 YPPHQDHSYFSQCALAREGLC*PNQWSQETEAACKGPSPHANQDPAYHHP 312 YPP Q ++ F++ + G PN S + GPSP Q P P Sbjct: 120 YPPGQQNA-FNRSPMMPNGT--PNMMSPPSMGRVPGPSPGGPQPPGPGQP 166 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,861,666 Number of Sequences: 27780 Number of extensions: 183489 Number of successful extensions: 421 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 412 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 421 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 576961812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -