BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_M04 (639 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 26 1.2 AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 25 2.0 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 25 2.0 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 25 2.0 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 24 4.7 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 6.2 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 8.2 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 8.2 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 25.8 bits (54), Expect = 1.2 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 242 PADSPVHHHRVATQSFLEMERGPAAEHRPP 331 P P+HH A+Q F+ +H PP Sbjct: 357 PIYQPLHHFSAASQRFMLRSCNSLGDHIPP 386 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -1 Query: 423 RWRGDSPAVSASDSLSVNLSAMWSISFSATEGG 325 +W D + + +LSV L +W F+A E G Sbjct: 77 KWGKDIEFLLSCIALSVGLGNVWRFPFTALENG 109 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -1 Query: 423 RWRGDSPAVSASDSLSVNLSAMWSISFSATEGG 325 +W D + + +LSV L +W F+A E G Sbjct: 77 KWGKDIEFLLSCIALSVGLGNVWRFPFTALENG 109 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 25.0 bits (52), Expect = 2.0 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -1 Query: 402 AVSASDSLSVNLSAMWSISFSATEGGRCSAAG 307 AV SLS+++++M S + + GGR S+ G Sbjct: 988 AVVRPQSLSLSMNSMGSDNSEQSSGGRLSSGG 1019 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 23.8 bits (49), Expect = 4.7 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 304 TFHLQETLSGHAMM 263 TFHL + LSGH + Sbjct: 928 TFHLSQVLSGHGFL 941 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 6.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -2 Query: 206 HPSSPGRASW 177 H SSPGR SW Sbjct: 1216 HKSSPGRGSW 1225 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.0 bits (47), Expect = 8.2 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +3 Query: 354 TTWPTNLPTVSQ 389 T WPT+ PT SQ Sbjct: 384 TDWPTHQPTTSQ 395 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.0 bits (47), Expect = 8.2 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -3 Query: 304 TFHLQETLSGH 272 TFHL + LSGH Sbjct: 988 TFHLSQVLSGH 998 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 572,156 Number of Sequences: 2352 Number of extensions: 11034 Number of successful extensions: 27 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -