BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_M03 (433 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38468| Best HMM Match : Ribosomal_L29 (HMM E-Value=1.5e-23) 76 1e-14 SB_38972| Best HMM Match : PIP5K (HMM E-Value=0) 30 0.93 SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 >SB_38468| Best HMM Match : Ribosomal_L29 (HMM E-Value=1.5e-23) Length = 131 Score = 76.2 bits (179), Expect = 1e-14 Identities = 41/82 (50%), Positives = 48/82 (58%) Frame = +1 Query: 52 KVKCSELRTKDXXXXXXXXXXXXXXXTNLRVAKVTGGVASKLSKIRVVRKAIARVYIVYH 231 KVK ELR K + LRVAKVTGG ASKLSKI+VVRK++ARV V Sbjct: 11 KVKAHELRGKKKDELLKQLDELKTELSQLRVAKVTGGAASKLSKIKVVRKSVARVLTVVS 70 Query: 232 QKMKVNLRNHYKNKKYKPLXFK 297 Q + NLR Y+ KKY PL + Sbjct: 71 QTQRDNLRKFYRKKKYLPLDLR 92 Score = 41.9 bits (94), Expect = 2e-04 Identities = 22/39 (56%), Positives = 27/39 (69%) Frame = +2 Query: 296 RAKKTRAMRKALTKHEAKIKTRKEIRKKSLFPPRVYAVK 412 R K TRAMR++LTK EA KT K+ +K + F R YAVK Sbjct: 92 RPKLTRAMRRSLTKKEASSKTLKQQKKLAHFSLRKYAVK 130 >SB_38972| Best HMM Match : PIP5K (HMM E-Value=0) Length = 426 Score = 29.9 bits (64), Expect = 0.93 Identities = 13/34 (38%), Positives = 22/34 (64%) Frame = +1 Query: 199 KAIARVYIVYHQKMKVNLRNHYKNKKYKPLXFKS 300 KA ++V + H K NL +H+K K+Y P+ F++ Sbjct: 70 KAYSKVRVDNHLFNKENLPSHFKFKEYCPMVFRN 103 >SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 3.8 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +1 Query: 232 QKMKVNLRNHYKNKKYKPLXFKSQEDPCYAQGSY*TRSKDQDEERDQKE 378 +K K N +N KNKK K + K +E+ + + ++++ E +KE Sbjct: 37 KKNKKNKKNKNKNKKKKKMKKKKEEEAEVGEKTLEAENEEEKIEETEKE 85 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,326,433 Number of Sequences: 59808 Number of extensions: 155596 Number of successful extensions: 395 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 363 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 395 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 822495283 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -