BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_L21 (654 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) 131 4e-31 SB_21643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_37029| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) 29 3.3 SB_50701| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_45038| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_40531| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_22008| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_37698| Best HMM Match : Ribosomal_S3Ae (HMM E-Value=5e-21) Length = 147 Score = 131 bits (317), Expect = 4e-31 Identities = 59/87 (67%), Positives = 74/87 (85%) Frame = +3 Query: 393 TLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYAQHTQVRAIRKKMCEIITRDVTN 572 TLIEA +DVKTTDGY+LR+FCIGFT + +KT YA+HTQ++AIRKKM +IITR+V+ Sbjct: 2 TLIEAAVDVKTTDGYLLRMFCIGFTKRRQNQIKKTAYAKHTQIKAIRKKMVDIITREVST 61 Query: 573 SELREVVNKLIPDSIAKDIEKACHGIY 653 ++L+EVVNKLIPDSI KDIEK+C IY Sbjct: 62 NDLKEVVNKLIPDSIGKDIEKSCQSIY 88 >SB_21643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1974 Score = 29.5 bits (63), Expect = 2.5 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = +3 Query: 225 VFEVSLADLQADTDAERSFRKFRLIAEYVQ 314 +F + +D+QA+++ FR+F L+ EYV+ Sbjct: 1176 IFNNTFSDVQANSNQIWKFRRFELVMEYVE 1205 >SB_37029| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) Length = 1102 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/57 (26%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = -3 Query: 412 MLASMRVCHFLTIHLSLSVVRSMPWKLQSTLRPCTYSAINLNLRKDLSA--SVSACR 248 ++ SM +C ++ + +SL R + + +L PC Y ++++L + + S+S CR Sbjct: 948 VVMSMSLCRYVHVVMSLCPCRYVHVVMSMSLCPCRYVVMSMSLCRYIHVVMSMSLCR 1004 >SB_50701| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 311 Score = 28.7 bits (61), Expect = 4.4 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 89 IVDPFTRKDWYDVKAPSMFSKRQ 157 +V+P+ KDW D SMFS RQ Sbjct: 98 LVEPWRWKDWEDFTQSSMFSGRQ 120 >SB_45038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 561 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 286 LRKDLSASVSACRSARETSKTLPFNPSEAIFV 191 LRK L S + RE + L FNP E+ +V Sbjct: 302 LRKQLIDMASVAKDLREIDELLKFNPDESAYV 333 >SB_40531| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 28.3 bits (60), Expect = 5.8 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = -3 Query: 178 VDKRGADLPLAEHRRSLDIVPIFASEWVDNLLLNTFFTALRQAFIFPDR 32 VD + + +++ D+ PIF + V LLL T FT L+ + DR Sbjct: 159 VDNQFVPFQTLQTKKAFDVEPIFNGKDVFLLLLWTLFTYLQVISVLNDR 207 >SB_22008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.9 bits (59), Expect = 7.6 Identities = 14/55 (25%), Positives = 26/55 (47%) Frame = +3 Query: 159 SAPRLSTVPRXTKIASEGLKGRVFEVSLADLQADTDAERSFRKFRLIAEYVQGRN 323 +AP P+ GL+ +V ++S + Q D D + + K+ + E GR+ Sbjct: 90 TAPLAGMDPQIVNSVILGLQQKVDDLSRQNRQQDVDLDEQYNKYAPVGEENDGRD 144 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,200,829 Number of Sequences: 59808 Number of extensions: 441138 Number of successful extensions: 1272 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1155 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1269 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -