BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_L18 (485 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17C9.03 |tif471||translation initiation factor eIF4G |Schizo... 25 4.6 SPBC19C7.02 |ubr1|SPBC32F12.14|N-end-recognizing protein Ubr1|Sc... 25 6.1 SPAC13D6.04c |btb3||BTB/POZ domain protein Btb3|Schizosaccharomy... 25 6.1 >SPAC17C9.03 |tif471||translation initiation factor eIF4G |Schizosaccharomyces pombe|chr 1|||Manual Length = 1403 Score = 25.4 bits (53), Expect = 4.6 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 Query: 404 PWRGEHXTRPARGSSESXRVSADQR 478 PWRG++ ++P+ SS S Q+ Sbjct: 105 PWRGDNTSKPSANSSAERTSSQHQK 129 >SPBC19C7.02 |ubr1|SPBC32F12.14|N-end-recognizing protein Ubr1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1958 Score = 25.0 bits (52), Expect = 6.1 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +2 Query: 149 STVLPAVEQPSVDAGFSVRHAFGEGHACG 235 +T+LP E+P++DA F +R A +GH+ G Sbjct: 60 NTLLP--ERPTIDASFLLRRA--QGHSEG 84 >SPAC13D6.04c |btb3||BTB/POZ domain protein Btb3|Schizosaccharomyces pombe|chr 1|||Manual Length = 523 Score = 25.0 bits (52), Expect = 6.1 Identities = 17/57 (29%), Positives = 27/57 (47%) Frame = +3 Query: 234 DCTLAAEGQTLKAHKVVLSACSPYFESVLSQQYDKHPIIILKDXKYAELRAMMDYMY 404 D A + + AHK L+A S YF+S S+ I +K E +++ Y+Y Sbjct: 168 DIVFAGQYGRVFAHKFYLAARSSYFKSKFSKLGPSEHEIEVKHFA-KEFESILRYLY 223 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,709,530 Number of Sequences: 5004 Number of extensions: 30551 Number of successful extensions: 71 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 188065158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -