BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_L12 (652 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55686| Best HMM Match : Ribosomal_S7 (HMM E-Value=0) 316 1e-86 SB_41261| Best HMM Match : Metallothio_11 (HMM E-Value=0.74) 28 5.7 SB_18806| Best HMM Match : RVT_1 (HMM E-Value=1.7e-14) 28 5.7 SB_23893| Best HMM Match : rve (HMM E-Value=3.1e-24) 28 7.6 SB_11402| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 >SB_55686| Best HMM Match : Ribosomal_S7 (HMM E-Value=0) Length = 272 Score = 316 bits (775), Expect = 1e-86 Identities = 148/179 (82%), Positives = 165/179 (92%) Frame = +2 Query: 116 VVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKR 295 VV + + A ++P+IKLFG+WS DVQVSD+SL DYI+VKEKY+ YLPH+AGRYA KR Sbjct: 69 VVDDDAAAVVAPEVPDIKLFGKWSTEDVQVSDISLTDYIAVKEKYSTYLPHTAGRYAAKR 128 Query: 296 FRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSG 475 FRKAQCPIVER+TNS+MMHGRNNGKKLM VRI+KH+FEIIHLLTGENPLQVLV AIINSG Sbjct: 129 FRKAQCPIVERITNSMMMHGRNNGKKLMTVRIIKHSFEIIHLLTGENPLQVLVNAIINSG 188 Query: 476 PREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELIN 652 PREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGARE+AFRNIK+IAEC+ADELIN Sbjct: 189 PREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGARESAFRNIKSIAECLADELIN 247 Score = 42.3 bits (95), Expect = 3e-04 Identities = 19/35 (54%), Positives = 26/35 (74%) Frame = +2 Query: 116 VVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSL 220 VV + + A ++P+IKLFG+WS DVQVSD+SL Sbjct: 6 VVDDDAAAVVAPEVPDIKLFGKWSTEDVQVSDISL 40 >SB_41261| Best HMM Match : Metallothio_11 (HMM E-Value=0.74) Length = 328 Score = 28.3 bits (60), Expect = 5.7 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -1 Query: 637 CNTLCDCFNISECSLTCTCAQKPDCLVDSA 548 C C C + C CTC Q C+V SA Sbjct: 226 CCVTCRCSVCTCCPCDCTCLQCAPCIVFSA 255 >SB_18806| Best HMM Match : RVT_1 (HMM E-Value=1.7e-14) Length = 556 Score = 28.3 bits (60), Expect = 5.7 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +2 Query: 155 IPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYA 286 IPE L C DV + LQ+++ + +KY YL + A +Y+ Sbjct: 511 IPEEAL--NLECPDVDFRESVLQEFLLLDKKYESYLEYLALKYS 552 >SB_23893| Best HMM Match : rve (HMM E-Value=3.1e-24) Length = 553 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = +3 Query: 24 TVRGYNFYLVIEKYQSWPR--RTGMTT*PR 107 +V G NF++V++ + WP T TT P+ Sbjct: 242 SVHGVNFFVVVDAHSKWPEIIATSSTTAPK 271 >SB_11402| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 753 Score = 27.9 bits (59), Expect = 7.6 Identities = 20/109 (18%), Positives = 41/109 (37%), Gaps = 1/109 (0%) Frame = +2 Query: 53 NRKVPIMAEENWNDDVAEAGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYI 232 +R+ + E+ W+ ++ G + T P + +L WS V D ++ ++I Sbjct: 619 DRQQRVRIEDEWSSQISPRGGIPQGTRLAPLLFAVLVNRLADEWSTRLKYVDDATVLEFI 678 Query: 233 SVKE-KYAKYLPHSAGRYAHKRFRKAQCPIVERLTNSLMMHGRNNGKKL 376 Y + RYA +R + + + + +G KL Sbjct: 679 PRNSPSYLPIVASGISRYATQRNMRLNPNKCKEMVIDFLHYGEQQKHKL 727 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,176,266 Number of Sequences: 59808 Number of extensions: 451253 Number of successful extensions: 1209 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1103 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1209 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -