BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_L11 (633 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) 157 9e-39 SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) 33 0.25 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 31 1.0 SB_8510| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) 28 5.5 SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) 28 5.5 SB_48206| Best HMM Match : LTXXQ (HMM E-Value=3) 28 7.2 SB_39979| Best HMM Match : RVT_1 (HMM E-Value=4.6e-12) 28 7.2 SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) 27 9.6 SB_26916| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_19612| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 SB_47345| Best HMM Match : Neural_ProG_Cyt (HMM E-Value=8.3) 27 9.6 SB_43496| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.6 >SB_20876| Best HMM Match : Ribosomal_S7e (HMM E-Value=0) Length = 157 Score = 157 bits (380), Expect = 9e-39 Identities = 76/114 (66%), Positives = 94/114 (82%) Frame = +2 Query: 26 STKIIKASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVP 205 S KI+K G A+ FE ISQA++ELE NSD+KAQLRELYI+ AKEI++ KK+III+VP Sbjct: 8 SAKIVKPQGETANEFEQGISQAILELEMNSDMKAQLRELYISSAKEIDVGGKKAIIIFVP 67 Query: 206 MPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILPKPSHKTRVANKQKRPRS 367 +P+++AFQKIQ RLVRELEKKFSGKHVV V R+ILP+P+ K+R KQKRPRS Sbjct: 68 VPQIRAFQKIQTRLVRELEKKFSGKHVVIVAQRRILPRPTRKSR-NQKQKRPRS 120 Score = 62.5 bits (145), Expect = 3e-10 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +3 Query: 480 HLDKNQQTTIEHKVDTFQSVYKKLTGREVTFEFP 581 HLDK QQTTI+HK++TF +VYKKLTG++V FEFP Sbjct: 121 HLDKTQQTTIDHKLETFSTVYKKLTGKDVVFEFP 154 >SB_44647| Best HMM Match : C_tripleX (HMM E-Value=0.00011) Length = 812 Score = 32.7 bits (71), Expect = 0.25 Identities = 30/129 (23%), Positives = 54/129 (41%), Gaps = 8/129 (6%) Frame = +2 Query: 5 SRKVVKMSTKIIKASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIE---LH 175 +R + S K D ++ + + + + K L+E+ I ++K+ E + Sbjct: 226 TRSTIARSPKHDDEKDNSGDDIDSDKEDSSGDAPHHEEKKEDLKEVVIKQSKQDEATAIK 285 Query: 176 NKKSIIIYVPMPKLKAFQKIQIRLVRELEKKFS-----GKHVVFVGDRKILPKPSHKTRV 340 + KS PKLKA Q + + KK K V+ LP+ +H+ Sbjct: 286 DSKSESKPASKPKLKAVQNDAPKKANKPAKKAKKPVKRAKKVLNKKKMDTLPRGAHRPAS 345 Query: 341 ANKQKRPRS 367 AN Q+RP++ Sbjct: 346 ANAQRRPQN 354 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 30.7 bits (66), Expect = 1.0 Identities = 36/119 (30%), Positives = 61/119 (51%), Gaps = 7/119 (5%) Frame = +2 Query: 17 VKMSTKI--IKASGAEADSFETSISQALVELETNSDLKAQLRE----LYITKAKEIELHN 178 V+MS ++ +++SG +S E+ + E N+ LK +L E L +T+ +E E+ N Sbjct: 1673 VRMSERVSVLESSGGTMNSEESFFLE-----EDNAILKRKLDEKETALKVTQDREREM-N 1726 Query: 179 KKSIIIYVPMPKLKAFQKIQIRLVRELEKKFSGKHVVFVGDRKILP-KPSHKTRVANKQ 352 K + +YV M KL++ Q ELEK+ ++ ++I P K S T VA + Sbjct: 1727 DKLMALYVNMSKLESTQGTLEEKNAELEKE------LYSAQQEIQPLKDSFNTAVAENE 1779 >SB_8510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 320 Score = 29.9 bits (64), Expect = 1.8 Identities = 16/60 (26%), Positives = 30/60 (50%) Frame = -3 Query: 565 TSRPVSFLYTDWKVSTLCSIVVCWFLSKCTLMSCEPSNLTLMRLPTISAGKTKSSRIASY 386 T+R ++ ++DW ++ C CW +S T+ S LT +++P + + K A Y Sbjct: 120 TNRCGAYYHSDWLIAIPCRRRACWTVSLITIFS---QVLTNIKVPIPAYSREKGYYTAHY 176 >SB_50950| Best HMM Match : AAA_5 (HMM E-Value=0.0006) Length = 1552 Score = 28.3 bits (60), Expect = 5.5 Identities = 15/57 (26%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +2 Query: 62 DSFETSISQALVELETNSDLKAQLRELYITKAKEIELHNKKSIIIYVPM-PKLKAFQ 229 + ++T ++ L + L+ +RELY +E E KKS++ ++ + PK+K + Sbjct: 171 EQWDTILTMIPARLVQSPQLQPYIRELYAEVKQEYEASIKKSMVQHILVKPKVKGVE 227 >SB_9051| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 1831 Score = 28.3 bits (60), Expect = 5.5 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 114 PTSKPNFGSFTLQKLKKLNYTIRS 185 P S N+G FT+++LK +YT +S Sbjct: 1415 PLSNDNYGDFTMRRLKVSSYTEQS 1438 >SB_48206| Best HMM Match : LTXXQ (HMM E-Value=3) Length = 513 Score = 27.9 bits (59), Expect = 7.2 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = -3 Query: 319 LRQDLTVSNKDYMFTTELLFELTDKPDLDLLKGLQFRHRHIDDDRLL 179 LRQ L SN +L L K D+ K +H+ DD LL Sbjct: 170 LRQRLNSSNPSISSPINILDALCQKHDIAYSKSKDLDDKHVADDNLL 216 >SB_39979| Best HMM Match : RVT_1 (HMM E-Value=4.6e-12) Length = 792 Score = 27.9 bits (59), Expect = 7.2 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 3/76 (3%) Frame = +3 Query: 327 TKPVLLTNK--RGHAQGH*PLVYDAILEDLVFPAEIVGKRIRVKLDGSQLIKVHLDKNQQ 500 TK +L+T K + + PL D + D + K + + LDG +VH+D+ + Sbjct: 713 TKAILVTGKWIGRNVEKDPPLCLDLKIGDSMIEEISSYKLLGITLDGQMTFEVHIDELSK 772 Query: 501 TTIEHK-VDTFQSVYK 545 T ++ T++S+ K Sbjct: 773 TFKTYRTTKTYKSLLK 788 >SB_56433| Best HMM Match : Metallophos (HMM E-Value=1.7e-15) Length = 417 Score = 27.5 bits (58), Expect = 9.6 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 9/42 (21%) Frame = +3 Query: 93 WSNSKPTPTSKPN--------FG-SFTLQKLKKLNYTIRSRS 191 WS+ KPTP KPN FG T Q L+K N+ + RS Sbjct: 125 WSDPKPTPGCKPNTFRGGGCYFGPDVTSQVLRKHNFELLVRS 166 >SB_26916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1732 Score = 27.5 bits (58), Expect = 9.6 Identities = 22/89 (24%), Positives = 42/89 (47%), Gaps = 2/89 (2%) Frame = +2 Query: 2 PSRKVVKMSTKII--KASGAEADSFETSISQALVELETNSDLKAQLRELYITKAKEIELH 175 P + +K ++ + S + + ++ + + L + DL +Q RE KA++ + + Sbjct: 932 PDKNTIKEGSRSVPFNLSALQEEEEDSDSANSFRALPSAVDLVSQGRE-GDGKAEDEDTN 990 Query: 176 NKKSIIIYVPMPKLKAFQKIQIRLVRELE 262 NK+ Y M KL + I +V ELE Sbjct: 991 NKEQTYDYTFMKKLPTGAEASIAMVGELE 1019 >SB_19612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 932 Score = 27.5 bits (58), Expect = 9.6 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -3 Query: 505 VVCWFLSKCTLMSCEPSNLTLMRLPTISAGKTKSSR 398 V+CW L + + + EP N L +L ++ GK K S+ Sbjct: 339 VICWVLGEYSYIVSEP-NTVLEQLHSLLDGKLKDSK 373 >SB_47345| Best HMM Match : Neural_ProG_Cyt (HMM E-Value=8.3) Length = 151 Score = 27.5 bits (58), Expect = 9.6 Identities = 11/26 (42%), Positives = 21/26 (80%) Frame = +2 Query: 200 VPMPKLKAFQKIQIRLVRELEKKFSG 277 VP+P++ A QK++ +L R++E+K +G Sbjct: 69 VPLPQVSAMQKVKGKL-RDMEQKLNG 93 >SB_43496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 380 Score = 27.5 bits (58), Expect = 9.6 Identities = 20/101 (19%), Positives = 49/101 (48%), Gaps = 8/101 (7%) Frame = +2 Query: 53 AEADSFETSISQALVELETNSDLKAQLRELYITKAKEI-----ELHNKKSIIIYVPMPKL 217 A+ + + Q E++T+ + K +RE ITK K + E +++++ + K+ Sbjct: 237 AQRKTLSDAAKQCSTEIKTSENKKMTIREDMITKRKHVRDRRREHREEETVLRKDELDKV 296 Query: 218 KAFQKIQIRLVRELEKKF---SGKHVVFVGDRKILPKPSHK 331 + + + +RE+E++F K+ + +R++ + K Sbjct: 297 AKLYEEEKQDLREMEQEFQNMEAKYNAILEERRLAAEAEKK 337 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,469,184 Number of Sequences: 59808 Number of extensions: 383261 Number of successful extensions: 1104 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1028 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1102 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -