BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_K15 (577 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L36067-1|AAA29362.1| 229|Anopheles gambiae polyubiquitin protein. 135 1e-33 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 7.1 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 7.1 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 7.1 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 23 7.1 DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfat... 23 9.4 AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylch... 23 9.4 AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylch... 23 9.4 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 23 9.4 >L36067-1|AAA29362.1| 229|Anopheles gambiae polyubiquitin protein. Length = 229 Score = 135 bits (326), Expect = 1e-33 Identities = 65/66 (98%), Positives = 66/66 (100%) Frame = +3 Query: 60 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKE 239 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKE Sbjct: 5 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 64 Query: 240 STLHLV 257 STLHLV Sbjct: 65 STLHLV 70 Score = 135 bits (326), Expect = 1e-33 Identities = 65/66 (98%), Positives = 66/66 (100%) Frame = +3 Query: 60 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKE 239 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKE Sbjct: 81 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 140 Query: 240 STLHLV 257 STLHLV Sbjct: 141 STLHLV 146 Score = 135 bits (326), Expect = 1e-33 Identities = 65/66 (98%), Positives = 66/66 (100%) Frame = +3 Query: 60 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKE 239 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKE Sbjct: 157 VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 216 Query: 240 STLHLV 257 STLHLV Sbjct: 217 STLHLV 222 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.0 bits (47), Expect = 7.1 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -3 Query: 503 VFEDHRAMTLPAVVTVLHHRHE 438 +F DHR PA V L HE Sbjct: 903 IFIDHRGHKAPAAVVGLQFLHE 924 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.0 bits (47), Expect = 7.1 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 17 VLVDSVRRVKMQIFCKDPHGQDHH 88 VLV R++K+ + K HG DHH Sbjct: 1807 VLVYDKRKLKVASYVKTHHG-DHH 1829 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.0 bits (47), Expect = 7.1 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 17 VLVDSVRRVKMQIFCKDPHGQDHH 88 VLV R++K+ + K HG DHH Sbjct: 1808 VLVYDKRKLKVASYVKTHHG-DHH 1830 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 23.0 bits (47), Expect = 7.1 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = -3 Query: 548 ASVPYRLEGTYLFVVVFEDHRAMTLPAVVTVLHHRHEHSG 429 +S+ +L T + V+ F DH+A+T+ + +R ++G Sbjct: 207 SSLETQLRTTDMHVLSFSDHKALTVRLCLPTPPNRLTNNG 246 >DQ230893-2|ABD94312.1| 525|Anopheles gambiae iduronate 2-sulfatase precursor protein. Length = 525 Score = 22.6 bits (46), Expect = 9.4 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 109 SDGSTSRVMVLPVRVFTENLH 47 +DG R ++ PVR+ T+ LH Sbjct: 170 ADGRLKRNLLCPVRLETQPLH 190 >AY705401-1|AAU12510.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 22.6 bits (46), Expect = 9.4 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 530 LEGTYLFVVVFEDHRAMTLPAVVTVLHHR 444 L GTY ++F ++ L VV HHR Sbjct: 293 LLGTYFNCIMFMVASSVVLTVVVLNYHHR 321 >AY705400-1|AAU12509.1| 490|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 6 protein. Length = 490 Score = 22.6 bits (46), Expect = 9.4 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 530 LEGTYLFVVVFEDHRAMTLPAVVTVLHHR 444 L GTY ++F ++ L VV HHR Sbjct: 293 LLGTYFNCIMFMVASSVVLTVVVLNYHHR 321 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 22.6 bits (46), Expect = 9.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +2 Query: 212 PLGLQYPEGIHPPPGV 259 P G+ P G H PPG+ Sbjct: 5 PPGVNRPPGSHRPPGL 20 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 573,523 Number of Sequences: 2352 Number of extensions: 11631 Number of successful extensions: 39 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54665910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -