BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_K13 (506 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 24 2.6 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 3.4 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 24 3.4 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 24 3.4 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 5.9 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 24.2 bits (50), Expect = 2.6 Identities = 11/48 (22%), Positives = 21/48 (43%) Frame = -2 Query: 502 IQDPIVPVVFDRSLVLFSTI*NGLEVQHXDQTNQIYHQIQDRYMQHDH 359 + DP + + S L + N +++Q Q Q++H + Q H Sbjct: 39 LHDPASSIARNASFTLGLGLANVIQLQQQQQQQQLHHSPHQYHQQVQH 86 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.8 bits (49), Expect = 3.4 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 290 YLSIGHFANNSPLVLSSNFMTNSFPFDTNL 201 Y S+G + LSSN ++N P D++L Sbjct: 1928 YNSVGKLKQRGIVKLSSNELSNYLPNDSDL 1957 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.8 bits (49), Expect = 3.4 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -1 Query: 290 YLSIGHFANNSPLVLSSNFMTNSFPFDTNL 201 Y S+G + LSSN ++N P D++L Sbjct: 1929 YNSVGKLKQRGIVKLSSNELSNYLPNDSDL 1958 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 23.8 bits (49), Expect = 3.4 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +2 Query: 116 FLKYHPEHLTEDIGQQIGTCKSHNGQVA 199 F+ PE+L E + G+ K+H+G A Sbjct: 29 FMDLPPEYLPERYQRIAGSIKTHHGSTA 56 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.0 bits (47), Expect = 5.9 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 424 QHXDQTNQIYHQIQDRYMQHDHYH 353 Q DQT+ Q + QH H+H Sbjct: 634 QKADQTDHHQSQQPQQQQQHQHHH 657 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 564,480 Number of Sequences: 2352 Number of extensions: 11503 Number of successful extensions: 26 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 45668772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -