BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_K11 (654 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g47510.1 68415.m05930 fumarate hydratase, putative / fumarase... 224 3e-59 At5g50950.2 68418.m06319 fumarate hydratase, putative / fumarase... 223 1e-58 At5g50950.1 68418.m06318 fumarate hydratase, putative / fumarase... 223 1e-58 At3g19390.1 68416.m02459 cysteine proteinase, putative / thiol p... 29 2.0 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 29 2.0 At5g13700.1 68418.m01595 polyamine oxidase, putative similar to ... 28 6.2 At4g11610.1 68417.m01859 C2 domain-containing protein contains I... 27 8.2 At2g43610.1 68415.m05421 glycoside hydrolase family 19 protein s... 27 8.2 >At2g47510.1 68415.m05930 fumarate hydratase, putative / fumarase, putative similar to SP|P55250 Fumarate hydratase, mitochondrial precursor (EC 4.2.1.2) (Fumarase) {Rhizopus oryzae}; contains Pfam profile PF00206: Lyase Length = 492 Score = 224 bits (548), Expect = 3e-59 Identities = 108/167 (64%), Positives = 128/167 (76%) Frame = +1 Query: 154 NISTTSVTARKEKDTFGELDVPDDKLYGAQTVRSVMNFPIGGIEERMPYPVIVAFGILKK 333 ++ + S + R+E+DTFG + VP DKL+GAQT RS+ NF IGG ERMP P++ AFG+LKK Sbjct: 24 SLRSYSTSFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGERERMPEPIVRAFGVLKK 83 Query: 334 AAAKVNIEYGLEKKIADAIMQACDDVISGKLYREGHFPLVIWQTGSGTQSNMNTNEVIAN 513 AAKVN+EYGL+ I AIMQA +V GKL HFPLV+WQTGSGTQSNMN NEVIAN Sbjct: 84 CAAKVNMEYGLDPTIGKAIMQAAQEVAEGKL--NDHFPLVVWQTGSGTQSNMNANEVIAN 141 Query: 514 RAIQILGGKLGSKDPVHPNDHVNKSQSSNDTYPTAMHIAVAMELRDR 654 RA +ILG K G K VHPNDHVN+SQSSNDT+PT MHIA A E+ R Sbjct: 142 RAAEILGRKRGEK-CVHPNDHVNRSQSSNDTFPTVMHIAAATEINSR 187 >At5g50950.2 68418.m06319 fumarate hydratase, putative / fumarase, putative similar to SP|P55250 Fumarate hydratase, mitochondrial precursor (EC 4.2.1.2) (Fumarase) {Rhizopus oryzae}; contains Pfam profile PF00206: Lyase Length = 499 Score = 223 bits (544), Expect = 1e-58 Identities = 107/162 (66%), Positives = 125/162 (77%) Frame = +1 Query: 169 SVTARKEKDTFGELDVPDDKLYGAQTVRSVMNFPIGGIEERMPYPVIVAFGILKKAAAKV 348 S R+E+DTFG + VP DKL+GAQT RS+ NF IGG ERMP P++ AFG+LKK AAKV Sbjct: 36 STPFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIVRAFGVLKKCAAKV 95 Query: 349 NIEYGLEKKIADAIMQACDDVISGKLYREGHFPLVIWQTGSGTQSNMNTNEVIANRAIQI 528 N+EYGL+ I +AIM+A +V GKL HFPLV+WQTGSGTQSNMN NEVIANRA +I Sbjct: 96 NMEYGLDPMIGEAIMEAAQEVAEGKL--NDHFPLVVWQTGSGTQSNMNANEVIANRAAEI 153 Query: 529 LGGKLGSKDPVHPNDHVNKSQSSNDTYPTAMHIAVAMELRDR 654 LG K G K VHPNDHVN+SQSSNDT+PT MHIA A E+ R Sbjct: 154 LGHKRGEK-IVHPNDHVNRSQSSNDTFPTVMHIAAATEITSR 194 >At5g50950.1 68418.m06318 fumarate hydratase, putative / fumarase, putative similar to SP|P55250 Fumarate hydratase, mitochondrial precursor (EC 4.2.1.2) (Fumarase) {Rhizopus oryzae}; contains Pfam profile PF00206: Lyase Length = 510 Score = 223 bits (544), Expect = 1e-58 Identities = 107/162 (66%), Positives = 125/162 (77%) Frame = +1 Query: 169 SVTARKEKDTFGELDVPDDKLYGAQTVRSVMNFPIGGIEERMPYPVIVAFGILKKAAAKV 348 S R+E+DTFG + VP DKL+GAQT RS+ NF IGG ERMP P++ AFG+LKK AAKV Sbjct: 36 STPFREERDTFGPIQVPSDKLWGAQTQRSLQNFEIGGDRERMPEPIVRAFGVLKKCAAKV 95 Query: 349 NIEYGLEKKIADAIMQACDDVISGKLYREGHFPLVIWQTGSGTQSNMNTNEVIANRAIQI 528 N+EYGL+ I +AIM+A +V GKL HFPLV+WQTGSGTQSNMN NEVIANRA +I Sbjct: 96 NMEYGLDPMIGEAIMEAAQEVAEGKL--NDHFPLVVWQTGSGTQSNMNANEVIANRAAEI 153 Query: 529 LGGKLGSKDPVHPNDHVNKSQSSNDTYPTAMHIAVAMELRDR 654 LG K G K VHPNDHVN+SQSSNDT+PT MHIA A E+ R Sbjct: 154 LGHKRGEK-IVHPNDHVNRSQSSNDTFPTVMHIAAATEITSR 194 >At3g19390.1 68416.m02459 cysteine proteinase, putative / thiol protease, putative contains similarity to cysteine proteinase RD21A (thiol protease) GI:435619, SP:P43297 from [Arabidopsis thaliana] Length = 452 Score = 29.5 bits (63), Expect = 2.0 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -3 Query: 619 WRWGTCRSSSATCSRGRWDAPGPCCPVSRPV 527 + WG C SATC D CCP S PV Sbjct: 386 YSWGCCPYESATCC----DDGSSCCPQSYPV 412 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 29.5 bits (63), Expect = 2.0 Identities = 18/52 (34%), Positives = 23/52 (44%) Frame = +3 Query: 432 RGSLPPRHLADWLRYSVQHEHERGDCEPRHTNTGRETGQQGPGASQRPREQV 587 RG LP R + E + D E T T +T + P + RPREQV Sbjct: 253 RGVLPSGGGVQEERRRLVFEPRKADTEVSETPTAVKTSKPSPFGAARPREQV 304 >At5g13700.1 68418.m01595 polyamine oxidase, putative similar to SP|O64411 Polyamine oxidase precursor (EC 1.5.3.11) from Zea mays Length = 472 Score = 27.9 bits (59), Expect = 6.2 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 6/67 (8%) Frame = +1 Query: 304 VIVAFGILKKAAAKVNIEYGLEKKIADAIMQACDDVISGKLYRE--GHFPLVI---WQTG 468 +I+ GI +AAKV +E G+E D ++ D I G+++++ G P+ + W G Sbjct: 7 IIIGAGISGISAAKVLVENGVE----DVLILEATDRIGGRIHKQNFGDVPVELGAGWIAG 62 Query: 469 -SGTQSN 486 G +SN Sbjct: 63 VGGKESN 69 >At4g11610.1 68417.m01859 C2 domain-containing protein contains INTERPRO:IPR000008 C2 domain Length = 1011 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -2 Query: 395 CMIASAIFFSSPYSILTLAAAFFSI 321 C IA+ +FF +P I+ A FF++ Sbjct: 959 CFIAAIVFFITPIQIVVALAGFFTM 983 >At2g43610.1 68415.m05421 glycoside hydrolase family 19 protein similar to chitinase GI:17799 from [Brassica napus]; contains Pfam profiles PF00182: Chitinase class I, PF00187: Chitin recognition protein Length = 281 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = -3 Query: 625 CAWRWGTCRSSSATCSRGRWDAPGPCCPVSRPVFVWRGS 509 C RWG C ++ A C G GPC +P GS Sbjct: 41 CCSRWGYCGTTKAYCGTG--CQSGPCNSKPKPTPTPSGS 77 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,334,788 Number of Sequences: 28952 Number of extensions: 311499 Number of successful extensions: 886 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 858 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 880 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -