BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_K08 (599 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13636| Best HMM Match : Ribosomal_L6e (HMM E-Value=0) 46 2e-05 SB_48087| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_28143| Best HMM Match : Neur_chan_memb (HMM E-Value=2.2) 28 6.6 SB_10801| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 >SB_13636| Best HMM Match : Ribosomal_L6e (HMM E-Value=0) Length = 112 Score = 46.4 bits (105), Expect = 2e-05 Identities = 20/34 (58%), Positives = 23/34 (67%) Frame = +2 Query: 494 PFAFNSCPLRRIPXRYVICTSTXISLGNFKLPKH 595 PF N PLRRIP YVI TST I + + KLP+H Sbjct: 2 PFKINGVPLRRIPQSYVIATSTHIDVSDVKLPEH 35 >SB_48087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1396 Score = 28.7 bits (61), Expect = 3.8 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = +1 Query: 277 NQNSTPQ---T*EVLLPHSGENPCLIWWPSIQQACTQDPTQP 393 NQ++ PQ T VL+PH G PC+ +P+ TQP Sbjct: 94 NQSTLPQGNATQWVLIPHKGSMPCIGTFPNAINTWIIPGTQP 135 >SB_28143| Best HMM Match : Neur_chan_memb (HMM E-Value=2.2) Length = 356 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 279 PEQYPSNVGSPSTPLRRKSVPHLVAVHSASMYAGSD 386 P Y ++ GSP+ +RK+ PH HS+ A D Sbjct: 112 PMAYLTSTGSPNPQRKRKNDPHRTIDHSSVHRASRD 147 >SB_10801| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 910 Score = 27.5 bits (58), Expect = 8.8 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = +2 Query: 401 GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPXRYVICTSTXISL 571 G +C+ L + ++V L ++ G++ FN L + ICT T +S+ Sbjct: 340 GLICMFLNKINKSRQVPLNSVIAVGVITGLSSLVFNMRELVELVAVATICTYTSVSV 396 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,461,583 Number of Sequences: 59808 Number of extensions: 386031 Number of successful extensions: 998 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 895 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 995 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1451595000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -