BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_K03 (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 26 1.2 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 25 2.1 DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosylt... 24 4.8 AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 24 4.8 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 24 4.8 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 25.8 bits (54), Expect = 1.2 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 2/34 (5%) Frame = -3 Query: 523 TCTKSICEEKRISNSC-SSLKNGQ-LYRILDSRS 428 TCT+ I E+ I+N C + +G+ LY I +S+S Sbjct: 425 TCTRVIPEDCEINNGCMEEITSGEILYAIKNSQS 458 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 25.0 bits (52), Expect = 2.1 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +3 Query: 360 PSXISERGHNAGGKGCLHI 416 P ++ H AGG+ C+H+ Sbjct: 288 PIKVNRELHKAGGRSCMHV 306 >DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosyltransferase 1 protein. Length = 399 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 427 YFDCQEYDRAAHFLENCTSSKCVFLHK 507 + D RA HF+ NC SS F+ + Sbjct: 338 HLDLAILGRANHFIGNCISSYSAFVKR 364 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 518 YKEYL*RKTHFELVQFSKKWAALSYS 441 + EYL R EL +F+ KW + +S Sbjct: 97 FNEYLPRGYRTELSRFNLKWQPMPFS 122 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 518 YKEYL*RKTHFELVQFSKKWAALSYS 441 + EYL R EL +F+ KW + +S Sbjct: 97 FNEYLPRGYRTELSRFNLKWQPMPFS 122 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 620,191 Number of Sequences: 2352 Number of extensions: 11408 Number of successful extensions: 23 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -