Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_K02
         (342 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal...    22   5.5  
CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.          22   7.2  
AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr...    21   9.6  

>AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal
           growth factor receptorprotein.
          Length = 1433

 Score = 22.2 bits (45), Expect = 5.5
 Identities = 8/10 (80%), Positives = 9/10 (90%)
 Frame = -2

Query: 71  QLVTNFSFGP 42
           Q+ TNFSFGP
Sbjct: 338 QVYTNFSFGP 347


>CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein.
          Length = 1494

 Score = 21.8 bits (44), Expect = 7.2
 Identities = 11/34 (32%), Positives = 17/34 (50%)
 Frame = -3

Query: 112  SFSYVGLSNNTWLFNLSRTFPLDHFFFLALPPPD 11
            S   + L++NT      R +P ++  F AL P D
Sbjct: 1391 SLQGITLTDNTRQLFFRRHYPSNNVSFCALDPDD 1424


>AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase
           protein.
          Length = 1253

 Score = 21.4 bits (43), Expect = 9.6
 Identities = 6/12 (50%), Positives = 8/12 (66%)
 Frame = -1

Query: 51  LWTTSSSWLCRH 16
           LW  S +W+ RH
Sbjct: 123 LWLLSQTWITRH 134


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 367,710
Number of Sequences: 2352
Number of extensions: 6889
Number of successful extensions: 10
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 563,979
effective HSP length: 57
effective length of database: 429,915
effective search space used: 24075240
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)