BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_J23 (653 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 22 3.8 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.9 AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory recept... 21 8.9 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/14 (50%), Positives = 12/14 (85%) Frame = +1 Query: 439 EDSVVVVPXXARTP 480 E++++V+P ARTP Sbjct: 5 EETILVIPTMARTP 18 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 8.9 Identities = 10/37 (27%), Positives = 14/37 (37%) Frame = -3 Query: 486 TTRSTCXXWHHDHAVLEPAHADMTDTAFALE*CPPGE 376 TTR T W + P M + + C PG+ Sbjct: 1071 TTRPTTTNWPTQGTTIPPPAVVMPEVDKPSQPCEPGQ 1107 >AM292381-1|CAL23193.2| 364|Tribolium castaneum gustatory receptor candidate 60 protein. Length = 364 Score = 21.0 bits (42), Expect = 8.9 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = -3 Query: 552 RCTTLTPPLTKLAFTW 505 RCT L K AF W Sbjct: 156 RCTKLCKEANKTAFLW 171 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,853 Number of Sequences: 336 Number of extensions: 4018 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -