BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_J13 (507 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 25 0.39 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 24 0.90 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 23 2.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.3 DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 21 8.4 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 25.0 bits (52), Expect = 0.39 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -1 Query: 495 IHVFFFLIPFSFHRRLRTTXVSIYLCLRIVVLSLST 388 I F L+P H RL +YL VVLSL + Sbjct: 13 ISKIFALLPVKKHHRLEKLVPCVYLTSFSVVLSLGS 48 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.8 bits (49), Expect = 0.90 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +1 Query: 85 VSIYLAQDVHSHQRFRRPEDKAGGSRRQARRDR 183 +S ++ ++ H + R ++GG RRQ R R Sbjct: 563 LSNHMVKNSHYKEHIMRSITESGGRRRQTREKR 595 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.6 bits (46), Expect = 2.1 Identities = 6/11 (54%), Positives = 10/11 (90%) Frame = +3 Query: 93 LSCPRCPFTSK 125 L+CP+CPF ++ Sbjct: 231 LTCPKCPFITE 241 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 6.3 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 165 TSSS*STSWRPGA 203 TS S +TSW PG+ Sbjct: 1350 TSVSTTTSWNPGS 1362 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 20.6 bits (41), Expect = 8.4 Identities = 8/35 (22%), Positives = 20/35 (57%) Frame = +1 Query: 388 RRQTQNNYP*TQVNRDXSCTQPPMETKWN*KKKNM 492 R+Q + +P + ++ + PP + + N +K+N+ Sbjct: 210 RKQLVSEHPDSPNSKKSATPSPPPQLEVNERKENL 244 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,618 Number of Sequences: 336 Number of extensions: 1641 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12049355 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -