BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_J01 (518 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 3.5 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 24 3.5 AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CY... 23 4.7 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 23 8.1 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.8 bits (49), Expect = 3.5 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 92 WPRIYLAVLGGKTTPAAADV 151 W +YL GG P+A++V Sbjct: 577 WTEVYLGSWGGHNQPSASEV 596 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.8 bits (49), Expect = 3.5 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 92 WPRIYLAVLGGKTTPAAADV 151 W +YL GG P+A++V Sbjct: 577 WTEVYLGSWGGHNQPSASEV 596 >AY176051-1|AAO19582.1| 522|Anopheles gambiae cytochrome P450 CYP12F1 protein. Length = 522 Score = 23.4 bits (48), Expect = 4.7 Identities = 17/55 (30%), Positives = 23/55 (41%) Frame = +2 Query: 122 GKTTPAAADVEKILSSVGIEADAEKLKKVITELNGKDVEQLIAAGREKLSSMPVG 286 GK A +EK G ++ EKL K +L +I AG + SS G Sbjct: 281 GKIDEAVRRIEKAPKMEGTQSVLEKLLKTNKQLAVVMAFDMIMAGIDTTSSSTFG 335 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -2 Query: 151 NVSGSWRGLATQHSQVNTRPRN 86 N +GSW G+ Q S P N Sbjct: 1109 NSAGSWAGMGKQESHYVMYPSN 1130 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 376,262 Number of Sequences: 2352 Number of extensions: 5409 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47360208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -