BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_I21 (654 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g26970.1 68415.m03235 exonuclease family protein contains exo... 139 1e-33 At5g44980.1 68418.m05516 F-box family protein contains F-box dom... 30 1.5 >At2g26970.1 68415.m03235 exonuclease family protein contains exonuclease domain, Pfam:PF00929 Length = 222 Score = 139 bits (337), Expect = 1e-33 Identities = 65/144 (45%), Positives = 94/144 (65%) Frame = +1 Query: 208 DIAQRIVWMDLEMTGLDIENDHIMEIACLVTDAQLNVVATGPDIVINLPEVTLNKMNNWC 387 D Q +VW+DLEMTGL++E D I+EIAC++T+ L GPD+V+ + L+KM++WC Sbjct: 41 DYKQPLVWIDLEMTGLNVEVDRILEIACIITNGDLTQSVEGPDLVVRQTKDCLDKMDDWC 100 Query: 388 KVQHGETGLTEACLKSDTSLAEAERIILKFVSNHVPEKICPLAGNSXYMDRMXLIKYMPK 567 + HG +GLT+ L S + EAE+ +++FV HV LAGNS Y+D + L KYMP+ Sbjct: 101 QTHHGASGLTKKVLLSAITEREAEQKVIEFVKKHVGSGNPLLAGNSVYVDFLFLKKYMPE 160 Query: 568 LXDYLHYRCIDVSTVKELAKRWYP 639 L + +DVS+VK L RW+P Sbjct: 161 LAALFPHILVDVSSVKALCARWFP 184 >At5g44980.1 68418.m05516 F-box family protein contains F-box domain Pfam:PF00646 Length = 435 Score = 29.9 bits (64), Expect = 1.5 Identities = 24/76 (31%), Positives = 36/76 (47%), Gaps = 1/76 (1%) Frame = +1 Query: 253 LDIENDHIMEIACLVTDAQLNVVATGPDIVINLPEVTLNKMNNWCKVQHGETG-LTEACL 429 +D + +I + LV+ NV D V++LP + + K+ N C HGE G L L Sbjct: 120 VDFKRQNIYKSKTLVSLKLHNVELKNSDFVVSLPCLKILKLENIC---HGEDGPLVVEKL 176 Query: 430 KSDTSLAEAERIILKF 477 S S+ E +I F Sbjct: 177 ISGCSVLEDLELIRPF 192 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,361,787 Number of Sequences: 28952 Number of extensions: 225833 Number of successful extensions: 511 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 511 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -