BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_I18 (499 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22230.1 68416.m02804 60S ribosomal protein L27 (RPL27B) simi... 87 8e-18 At4g15000.1 68417.m02304 60S ribosomal protein L27 (RPL27C) 85 3e-17 At2g32220.1 68415.m03937 60S ribosomal protein L27 (RPL27A) 84 4e-17 At1g18540.1 68414.m02313 60S ribosomal protein L6 (RPL6A) simila... 36 0.020 At1g74060.1 68414.m08578 60S ribosomal protein L6 (RPL6B) simila... 33 0.14 At1g74050.1 68414.m08576 60S ribosomal protein L6 (RPL6C) simila... 33 0.14 At5g63900.1 68418.m08023 PHD finger family protein contains Pfam... 30 0.75 At1g72440.1 68414.m08377 CCAAT-box-binding transcription factor-... 29 1.7 At1g66070.1 68414.m07499 translation initiation factor-related s... 29 1.7 At4g35120.1 68417.m04992 kelch repeat-containing F-box family pr... 28 4.0 At3g63310.1 68416.m07121 expressed protein low similarity to N-m... 28 4.0 At5g67570.1 68418.m08520 pentatricopeptide (PPR) repeat-containi... 27 9.3 At2g24080.1 68415.m02876 F-box family protein-related similar to... 27 9.3 At1g42540.1 68414.m04905 glutamate receptor family protein (GLR3... 27 9.3 >At3g22230.1 68416.m02804 60S ribosomal protein L27 (RPL27B) similar to 60S RIBOSOMAL PROTEIN L27 GB:P41101 from [Solanum tuberosum] Length = 135 Score = 86.6 bits (205), Expect = 8e-18 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 1/86 (1%) Frame = +3 Query: 198 PGKVHKRMGKNKIHKRSKIKPFVKVVNYNHLMPTRYTVDFSFEKFSAKD-LKDPAKRKKL 374 P KV ++ K K+S++K F+K+VNY HLMPTRYT+D ++ + D LK K+ Sbjct: 50 PSKVIRKDSAKKTAKKSRVKCFIKLVNYQHLMPTRYTLDVDLKEVATLDALKSKDKKVTA 109 Query: 375 RFNTRVRFEERYKSGKNKWFFQKLRF 452 + + EER+K+GKN+WFF KLRF Sbjct: 110 LKEAKAKLEERFKTGKNRWFFTKLRF 135 Score = 51.6 bits (118), Expect = 3e-07 Identities = 21/50 (42%), Positives = 34/50 (68%) Frame = +1 Query: 49 MGKIMKPGKVVLVLSGRYAGRKAIVVKNYDEGTSXQAIRACLRRWYRQVP 198 M K +K K V++L GRYAG+KA+++K++D+GTS + CL ++ P Sbjct: 1 MVKFLKQNKAVILLQGRYAGKKAVIIKSFDDGTSDRRYGHCLVAGLKKYP 50 Score = 27.9 bits (59), Expect = 4.0 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +2 Query: 161 YGHAFVAGIDRYPRXSAQEDGKE*NPQEVQDKAF 262 YGH VAG+ +YP ++D + ++ + K F Sbjct: 38 YGHCLVAGLKKYPSKVIRKDSAKKTAKKSRVKCF 71 >At4g15000.1 68417.m02304 60S ribosomal protein L27 (RPL27C) Length = 135 Score = 85.0 bits (201), Expect = 3e-17 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 1/86 (1%) Frame = +3 Query: 198 PGKVHKRMGKNKIHKRSKIKPFVKVVNYNHLMPTRYTVDFSFEKFSAKD-LKDPAKRKKL 374 P KV ++ K K+S++K F+K+VNY HLMPTRYT+D ++ + D L+ K+ Sbjct: 50 PSKVIRKDSAKKTAKKSRVKCFIKLVNYQHLMPTRYTLDVDLKEVATLDALQSKDKKVAA 109 Query: 375 RFNTRVRFEERYKSGKNKWFFQKLRF 452 + + EER+K+GKN+WFF KLRF Sbjct: 110 LKEAKAKLEERFKTGKNRWFFTKLRF 135 Score = 47.6 bits (108), Expect = 5e-06 Identities = 19/50 (38%), Positives = 32/50 (64%) Frame = +1 Query: 49 MGKIMKPGKVVLVLSGRYAGRKAIVVKNYDEGTSXQAIRACLRRWYRQVP 198 M K +K K V++L GRYAG+KA+++K++D+G + CL ++ P Sbjct: 1 MVKFLKQNKAVILLQGRYAGKKAVIIKSFDDGNRDRPYGHCLVAGLKKYP 50 Score = 31.5 bits (68), Expect = 0.33 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 155 KPYGHAFVAGIDRYPRXSAQEDGKE*NPQEVQDKAF 262 +PYGH VAG+ +YP ++D + ++ + K F Sbjct: 36 RPYGHCLVAGLKKYPSKVIRKDSAKKTAKKSRVKCF 71 >At2g32220.1 68415.m03937 60S ribosomal protein L27 (RPL27A) Length = 135 Score = 84.2 bits (199), Expect = 4e-17 Identities = 38/86 (44%), Positives = 54/86 (62%), Gaps = 1/86 (1%) Frame = +3 Query: 198 PGKVHKRMGKNKIHKRSKIKPFVKVVNYNHLMPTRYTVDFSFEK-FSAKDLKDPAKRKKL 374 P KV ++ K K+S++K F KV+NY H+MPTRYT+D + SA + K+ Sbjct: 50 PSKVIRKDSAKKTAKKSRVKCFFKVINYQHVMPTRYTLDLDLKNVVSADAISSKDKKVTA 109 Query: 375 RFNTRVRFEERYKSGKNKWFFQKLRF 452 + +FEER+K+GKN+WFF KLRF Sbjct: 110 LKEAKAKFEERFKTGKNRWFFTKLRF 135 Score = 54.4 bits (125), Expect = 4e-08 Identities = 23/50 (46%), Positives = 34/50 (68%) Frame = +1 Query: 49 MGKIMKPGKVVLVLSGRYAGRKAIVVKNYDEGTSXQAIRACLRRWYRQVP 198 M K MKPGK V++L GRY G+KA++VK++D+GT + CL ++ P Sbjct: 1 MVKCMKPGKAVILLQGRYTGKKAVIVKSFDDGTVEKKYGHCLVAGLKKYP 50 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +2 Query: 155 KPYGHAFVAGIDRYPRXSAQEDGKE*NPQEVQDKAF 262 K YGH VAG+ +YP ++D + ++ + K F Sbjct: 36 KKYGHCLVAGLKKYPSKVIRKDSAKKTAKKSRVKCF 71 >At1g18540.1 68414.m02313 60S ribosomal protein L6 (RPL6A) similar to 60S ribosomal protein L6 GI:7208784 from [Cicer arietinum] Length = 233 Score = 35.5 bits (78), Expect = 0.020 Identities = 13/42 (30%), Positives = 26/42 (61%) Frame = +1 Query: 19 VNE*REYPSKMGKIMKPGKVVLVLSGRYAGRKAIVVKNYDEG 144 VN + P+K+ + PG V+++L+GR+ G++ + +K G Sbjct: 75 VNRRKPKPTKLKASITPGTVLIILAGRFKGKRVVFLKQLSSG 116 >At1g74060.1 68414.m08578 60S ribosomal protein L6 (RPL6B) similar to 60S ribosomal protein L6 (YL 16 like) GB:CAB57309 from [Cyanophora paradoxa] Length = 233 Score = 32.7 bits (71), Expect = 0.14 Identities = 11/35 (31%), Positives = 23/35 (65%) Frame = +1 Query: 40 PSKMGKIMKPGKVVLVLSGRYAGRKAIVVKNYDEG 144 P+K+ + PG V+++L+GR+ G++ + +K G Sbjct: 82 PAKLRASITPGTVLIILAGRFKGKRVVFLKQLASG 116 >At1g74050.1 68414.m08576 60S ribosomal protein L6 (RPL6C) similar to 60S ribosomal protein L6 (YL 16 like) GB:CAB57309 from [Cyanophora paradoxa] Length = 233 Score = 32.7 bits (71), Expect = 0.14 Identities = 11/35 (31%), Positives = 23/35 (65%) Frame = +1 Query: 40 PSKMGKIMKPGKVVLVLSGRYAGRKAIVVKNYDEG 144 P+K+ + PG V+++L+GR+ G++ + +K G Sbjct: 82 PTKLRASITPGTVLIILAGRFKGKRVVFLKQLASG 116 >At5g63900.1 68418.m08023 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 557 Score = 30.3 bits (65), Expect = 0.75 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +3 Query: 378 FNTRVRFEERYKSGKNKWFF 437 +N R + E+RYKS K KWF+ Sbjct: 58 YNKRNKKEQRYKSPKGKWFY 77 >At1g72440.1 68414.m08377 CCAAT-box-binding transcription factor-related similar to CCAAT-box-binding transcription factor (CCAAT-binding factor) (CBF) (Swiss-Prot:Q03701) [Homo sapiens], GB:P53569 [Mus musculus] Length = 1056 Score = 29.1 bits (62), Expect = 1.7 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = +3 Query: 216 RMGKNKIHKRSKIKPFVKVVNYNHLMPTRYTVDFSFEKFSAKDLKDPAKRKK 371 R K K KR + PF + Y HL+ D K K +P K+KK Sbjct: 1000 RSKKKKKEKRKRKSPFASLEEYKHLIDQDEKED---SKTKRKATSEPTKKKK 1048 >At1g66070.1 68414.m07499 translation initiation factor-related similar to Eukaryotic translation initiation factor 3 subunit 1 (eIF-3 alpha) (eIF3 p35) (eIF3j) (Swiss-Prot:O75822) [Homo sapiens] Length = 226 Score = 29.1 bits (62), Expect = 1.7 Identities = 18/60 (30%), Positives = 29/60 (48%) Frame = +3 Query: 249 KIKPFVKVVNYNHLMPTRYTVDFSFEKFSAKDLKDPAKRKKLRFNTRVRFEERYKSGKNK 428 +IKP+ K +Y L+ T + S A D+KD A N +++ E+ +GK K Sbjct: 139 RIKPYEKSYHYIALLKT--IMRLSLTNMKAADVKDVASSITTIANEKLKAEKEAAAGKKK 196 >At4g35120.1 68417.m04992 kelch repeat-containing F-box family protein contains F-box domain Pfam:PF00646 and Kelch motif Pfam:PF01344 Length = 389 Score = 27.9 bits (59), Expect = 4.0 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -2 Query: 261 KALSWTSCGFYSFPSSCALXRGYLSIPATKACPY 160 ++LS S FYS SS + I AT+ CPY Sbjct: 48 RSLSLVSKSFYSLLSSTEIYAARSHIGATEPCPY 81 >At3g63310.1 68416.m07121 expressed protein low similarity to N-methyl-D-aspartate receptor-associated protein [Drosophila melanogaster] GI:567104; contains Pfam profile PF01027: Uncharacterized protein family UPF0005 Length = 239 Score = 27.9 bits (59), Expect = 4.0 Identities = 24/69 (34%), Positives = 35/69 (50%), Gaps = 1/69 (1%) Frame = -1 Query: 412 LYLSSKRTRVLKRSFLRLAGSFRSFALNFS-KLKSTV*RVGIK*L*FTTLTKGFILDLLW 236 LY + L+ SF+R S S L + + +TV +V + FTT T GF L +L Sbjct: 15 LYPMMSESPELRWSFIRKVYSIISIQLLVTIAVAATVVKVHSISVFFTTTTAGFALYILL 74 Query: 235 ILFFPILLC 209 IL I++C Sbjct: 75 ILTPLIVMC 83 >At5g67570.1 68418.m08520 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 611 Score = 26.6 bits (56), Expect = 9.3 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +3 Query: 192 GTPGKVHKRMGKNKIHKRSKIKPFVKVVNYN--HLMPTRYTVDFSFEKFSAKDLK 350 GT + K G+N + +K + F ++V+ HL+P YT F E SA+ L+ Sbjct: 517 GTANMMLKVYGRNDMFSEAK-ELFEEIVSRKETHLVPNEYTYSFMLEA-SARSLQ 569 >At2g24080.1 68415.m02876 F-box family protein-related similar to F-box protein family, AtFBX7 (GI:20197899) [Arabidopsis thaliana] Length = 374 Score = 26.6 bits (56), Expect = 9.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 78 YFTRLHYFAHLGGIFPLLVDI 16 YFTR F H G P LVDI Sbjct: 324 YFTRNDRFGHKDGSIPCLVDI 344 >At1g42540.1 68414.m04905 glutamate receptor family protein (GLR3.3) plant glutamate receptor family, PMID:11379626 Length = 933 Score = 26.6 bits (56), Expect = 9.3 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -3 Query: 410 VPLFKTYSRVETQLLTFSRVFQVFCAEFFKAEVNCI 303 VPL +Y +Q+ +F+ FC + F A VN + Sbjct: 470 VPLRVSYKEFVSQIRGTENMFKGFCIDVFTAAVNLL 505 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,486,102 Number of Sequences: 28952 Number of extensions: 204886 Number of successful extensions: 579 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 576 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 878448512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -