BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_I08 (419 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q17L04 Cluster: Putative uncharacterized protein; n=1; ... 56 3e-07 UniRef50_Q7PSG3 Cluster: ENSANGP00000019800; n=1; Anopheles gamb... 54 1e-06 UniRef50_UPI0000D57151 Cluster: PREDICTED: hypothetical protein;... 52 4e-06 UniRef50_UPI0000DB773B Cluster: PREDICTED: hypothetical protein;... 40 0.027 UniRef50_UPI000065F3B8 Cluster: Homolog of Homo sapiens "Splice ... 32 4.1 UniRef50_Q5RH37 Cluster: Novel protein similar to vertebrate lam... 32 4.1 UniRef50_Q9ZNZ7 Cluster: Ferredoxin-dependent glutamate synthase... 32 4.1 UniRef50_Q5N7H9 Cluster: PHD finger protein-like; n=2; Oryza sat... 32 5.4 UniRef50_Q25431 Cluster: ECM 18; n=1; Lytechinus variegatus|Rep:... 31 7.2 UniRef50_Q8C687 Cluster: 10 days neonate skin cDNA, RIKEN full-l... 31 9.5 UniRef50_A6LEX9 Cluster: Putative outer membrane protein, probab... 31 9.5 UniRef50_A2E1Y2 Cluster: Putative uncharacterized protein; n=1; ... 31 9.5 >UniRef50_Q17L04 Cluster: Putative uncharacterized protein; n=1; Aedes aegypti|Rep: Putative uncharacterized protein - Aedes aegypti (Yellowfever mosquito) Length = 108 Score = 56.0 bits (129), Expect = 3e-07 Identities = 21/59 (35%), Positives = 32/59 (54%) Frame = +3 Query: 165 CAPTTPCAWTVYSPVSKMIQTNMTNRFCICSADTTCAITEDDTEVHAYIHRCTRIDPDS 341 C T C W VY P ++ I+ M N C C T C T+DD + A+++RC + D ++ Sbjct: 49 CTDNTACGWAVYKPFTRSIENYMRNT-CSCPEPTKCIRTDDDLSISAFVYRCRKTDSET 106 >UniRef50_Q7PSG3 Cluster: ENSANGP00000019800; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000019800 - Anopheles gambiae str. PEST Length = 115 Score = 54.0 bits (124), Expect = 1e-06 Identities = 21/52 (40%), Positives = 29/52 (55%) Frame = +3 Query: 165 CAPTTPCAWTVYSPVSKMIQTNMTNRFCICSADTTCAITEDDTEVHAYIHRC 320 C TPC W VY+P ++ I + M N C C C T+DD + AY++RC Sbjct: 52 CEGNTPCGWAVYTPATRAIDSFMKNT-CDCEKLKQCVRTDDDVSISAYVYRC 102 >UniRef50_UPI0000D57151 Cluster: PREDICTED: hypothetical protein; n=1; Tribolium castaneum|Rep: PREDICTED: hypothetical protein - Tribolium castaneum Length = 106 Score = 52.4 bits (120), Expect = 4e-06 Identities = 22/57 (38%), Positives = 34/57 (59%) Frame = +3 Query: 162 ICAPTTPCAWTVYSPVSKMIQTNMTNRFCICSADTTCAITEDDTEVHAYIHRCTRID 332 IC TPC W VY+ +++ I M N+ C C+ + C +DD + AY++RC +ID Sbjct: 45 ICQGRTPCGWAVYNKMTRFIDYFMRNK-CECNKEKRCLRDDDDISITAYVYRC-KID 99 >UniRef50_UPI0000DB773B Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 134 Score = 39.5 bits (88), Expect = 0.027 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +3 Query: 177 TPCAWTVYSPVSKMIQTNMTNRFCICSADT-TCAITEDDTEVHAYIHRC 320 TPC W Y+PV++ M N C C +T C T ++ + AY++ C Sbjct: 66 TPCGWNTYNPVTRRSTIFMPNT-CKCPDETYKCVRTGENVSMSAYVYHC 113 >UniRef50_UPI000065F3B8 Cluster: Homolog of Homo sapiens "Splice Isoform 4 of Kinesin-like motor protein C20orf23; n=2; Coelomata|Rep: Homolog of Homo sapiens "Splice Isoform 4 of Kinesin-like motor protein C20orf23 - Takifugu rubripes Length = 3070 Score = 32.3 bits (70), Expect = 4.1 Identities = 20/63 (31%), Positives = 28/63 (44%), Gaps = 3/63 (4%) Frame = -1 Query: 242 SVCHVSLYHLRNWRINSPGAR---SSRGANYGLISRCLCHFCGSRRFCCFGSLCRRLSGI 72 +VC +S H+ N + S R S Y L CH R FCC + R+ +G+ Sbjct: 2962 TVCQLSKIHMFNQSVRSVWTRPLDDSTQLVYILTDPSSCHLSQPRDFCCLSTQSRQ-AGM 3020 Query: 71 CYL 63 C L Sbjct: 3021 CVL 3023 >UniRef50_Q5RH37 Cluster: Novel protein similar to vertebrate laminin, beta family protein; n=1; Danio rerio|Rep: Novel protein similar to vertebrate laminin, beta family protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 1713 Score = 32.3 bits (70), Expect = 4.1 Identities = 19/48 (39%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = -1 Query: 146 RCLCHFCGSRRFCCFGSLCR--RLSGICYLEP-VLGNIGSRESTNRQN 12 RC+C+ GS R C LC R+SG C P V G + R + N N Sbjct: 996 RCMCNLVGSSRQSCVDGLCECDRISGQCPCLPGVEGQLCDRCAPNTWN 1043 >UniRef50_Q9ZNZ7 Cluster: Ferredoxin-dependent glutamate synthase 1, chloroplast precursor; n=63; cellular organisms|Rep: Ferredoxin-dependent glutamate synthase 1, chloroplast precursor - Arabidopsis thaliana (Mouse-ear cress) Length = 1648 Score = 32.3 bits (70), Expect = 4.1 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = -1 Query: 371 AISCQHTKLLRVGINASASVNVRVHFCIVFGNSACGVG*ANAESVC-HVSLYHLRNWRIN 195 A+ H L++ G+ SAS+ C + AC VG A +VC +++L R WR++ Sbjct: 757 AVGAVHQHLIQNGLRMSASIVADTAQCFSTHHFACLVG-YGASAVCPYLALETCRQWRLS 815 Query: 194 S 192 + Sbjct: 816 N 816 >UniRef50_Q5N7H9 Cluster: PHD finger protein-like; n=2; Oryza sativa|Rep: PHD finger protein-like - Oryza sativa subsp. japonica (Rice) Length = 175 Score = 31.9 bits (69), Expect = 5.4 Identities = 13/41 (31%), Positives = 17/41 (41%) Frame = -1 Query: 248 AESVCHVSLYHLRNWRINSPGARSSRGANYGLISRCLCHFC 126 A S+C YH+R R + +G Y CLC C Sbjct: 37 AHSLCPYKFYHIRCLRYEQIASSEQQGNEYWYCPSCLCRVC 77 >UniRef50_Q25431 Cluster: ECM 18; n=1; Lytechinus variegatus|Rep: ECM 18 - Lytechinus variegatus (Sea urchin) Length = 505 Score = 31.5 bits (68), Expect = 7.2 Identities = 20/52 (38%), Positives = 23/52 (44%) Frame = +3 Query: 183 CAWTVYSPVSKMIQTNMTNRFCICSADTTCAITEDDTEVHAYIHRCTRIDPD 338 C Y V + + N T FC C ADT + DTEVH C R PD Sbjct: 291 CTQDGYYAVEQCYEGNGT--FCWC-ADTETGAVKPDTEVHGARADCERFLPD 339 >UniRef50_Q8C687 Cluster: 10 days neonate skin cDNA, RIKEN full-length enriched library, clone:4732458P17 product:zinc finger protein 101, full insert sequence; n=14; Murinae|Rep: 10 days neonate skin cDNA, RIKEN full-length enriched library, clone:4732458P17 product:zinc finger protein 101, full insert sequence - Mus musculus (Mouse) Length = 612 Score = 31.1 bits (67), Expect = 9.5 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +2 Query: 11 DSGGLCFRGCQCSQGQAPSNRYRSTDD 91 + G C RGCQC Q QA S Y +D Sbjct: 70 EKDGECERGCQCEQTQAQSPEYIVNED 96 >UniRef50_A6LEX9 Cluster: Putative outer membrane protein, probably involved in nutrient binding; n=1; Parabacteroides distasonis ATCC 8503|Rep: Putative outer membrane protein, probably involved in nutrient binding - Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC11152) Length = 1038 Score = 31.1 bits (67), Expect = 9.5 Identities = 19/60 (31%), Positives = 33/60 (55%) Frame = -1 Query: 395 MNKLFYSGAISCQHTKLLRVGINASASVNVRVHFCIVFGNSACGVG*ANAESVCHVSLYH 216 +N+L ++ Q TK LR+G+N + RV+ + NS GVG A + +VS+++ Sbjct: 348 LNRLSLKADLTQQATKWLRIGLNGQMT-RTRVNGVMNDENSLGGVGFAGTRMLPNVSVFN 406 >UniRef50_A2E1Y2 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 1785 Score = 31.1 bits (67), Expect = 9.5 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 28 LSRLPMFPRTGSK*QIPLNRRHKLPKQQKRREPQ 129 ++ LP+ PR +K Q P + LPK+Q+ PQ Sbjct: 947 INELPVSPRNRNKIQSPTKSKEVLPKKQENTRPQ 980 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 358,797,573 Number of Sequences: 1657284 Number of extensions: 5921976 Number of successful extensions: 14420 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 13956 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14413 length of database: 575,637,011 effective HSP length: 93 effective length of database: 421,509,599 effective search space used: 19389441554 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -