SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fprWP01_F_I08
         (419 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF222296-1|ABN79656.2|  403|Tribolium castaneum arginine vasopre...    22   2.1  
AY531876-2|AAT08871.1|  340|Tribolium castaneum tyrosine recombi...    21   6.4  

>EF222296-1|ABN79656.2|  403|Tribolium castaneum arginine
           vasopressin receptor protein.
          Length = 403

 Score = 22.2 bits (45), Expect = 2.1
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 162 ICAPTTPCAWT 194
           IC P T C+WT
Sbjct: 142 ICYPLTYCSWT 152


>AY531876-2|AAT08871.1|  340|Tribolium castaneum tyrosine
           recombinase protein.
          Length = 340

 Score = 20.6 bits (41), Expect = 6.4
 Identities = 14/49 (28%), Positives = 21/49 (42%)
 Frame = -1

Query: 248 AESVCHVSLYHLRNWRINSPGARSSRGANYGLISRCLCHFCGSRRFCCF 102
           AES    S+Y   + R  +  A + +G +  LI +       SR F  F
Sbjct: 275 AESGVDTSIYTAHSTRHAATSAAARKGISLDLIRKTAGWSATSRVFATF 323


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 86,876
Number of Sequences: 336
Number of extensions: 1533
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 51
effective length of database: 105,449
effective search space used:  9279512
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -