BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_I01 (652 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 42 4e-06 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 29 0.052 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 24 1.5 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 3.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 3.4 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 42.3 bits (95), Expect = 4e-06 Identities = 18/44 (40%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Frame = +3 Query: 129 VEKVLDRRIKNGVLEYYLKWKGYSDEDNTWEPEDNL-DCPDLIQ 257 VE++L ++ GV Y +KWK + + NTWEP NL +C D+++ Sbjct: 246 VEQILAKKEIKGVPTYLIKWKNWDLKYNTWEPISNLINCSDILE 289 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 28.7 bits (61), Expect = 0.052 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -1 Query: 547 TTCGHRTLACFAG-TRSASSVPCHFMRNMSSPLLS 446 TTC T+ CF G R + C ++ + P+LS Sbjct: 290 TTCSGHTVRCFTGGPRKSHESQCPMLQKLEKPVLS 324 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.8 bits (49), Expect = 1.5 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 581 VPCEPFFIKLNNYLWAPHI 525 V C+ + +NN+LW P I Sbjct: 60 VVCDVAYNNVNNWLWTPFI 78 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.6 bits (46), Expect = 3.4 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -3 Query: 515 CWYKICFICSLP 480 CW+KIC+ + P Sbjct: 489 CWWKICWTITTP 500 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 22.6 bits (46), Expect = 3.4 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -3 Query: 515 CWYKICFICSLP 480 CW+KIC+ + P Sbjct: 542 CWWKICWTITTP 553 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,698 Number of Sequences: 438 Number of extensions: 2733 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -