BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_H22 (510 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 26 0.22 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 21 6.4 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 25.8 bits (54), Expect = 0.22 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -2 Query: 254 TDIDAFQGFGEQTWPIWLYIYSRRFQDGGNFLTSYXQHHHPP 129 TD+D F+G WP+ L +R + GN L Q +PP Sbjct: 515 TDLDDFKGVCGMKWPL-LSTINRHLR--GNELLPMQQSQNPP 553 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.0 bits (42), Expect = 6.4 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 159 EKISTILKAAAVDVEPYWPGLFAKAL 236 EKI +L+ P PG FAK L Sbjct: 340 EKIYGVLEEYTRTTHPNEPGRFAKLL 365 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,984 Number of Sequences: 336 Number of extensions: 1726 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12154132 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -