BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_H21 (656 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock prote... 24 1.3 EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 23 1.7 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 23 1.7 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 1.7 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 1.7 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 1.7 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 1.7 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 22 3.9 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 22 3.9 AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle pr... 21 8.9 >EF633444-1|ABR32189.1| 721|Tribolium castaneum heat shock protein 90 protein. Length = 721 Score = 23.8 bits (49), Expect = 1.3 Identities = 12/51 (23%), Positives = 22/51 (43%) Frame = +1 Query: 277 EEKSYNLEKRKLDESSASFDDNNLEFKKTKIEITEDKNDSKTKKRGQNKSR 429 +E+ L + +E + + + K KIE + D TKK + K + Sbjct: 217 KEREKELSDDEAEEEKKEEEGEDKDKDKPKIEDVGEDEDEDTKKEDKKKKK 267 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 23.4 bits (48), Expect = 1.7 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = -3 Query: 252 IFIFYCTNSCV 220 +F+F CTNSC+ Sbjct: 316 LFLFACTNSCM 326 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 23.4 bits (48), Expect = 1.7 Identities = 7/11 (63%), Positives = 10/11 (90%) Frame = -3 Query: 252 IFIFYCTNSCV 220 +F+F CTNSC+ Sbjct: 316 LFLFACTNSCM 326 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.7 Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +1 Query: 328 SFDDNNLEFKKTKIEITEDKNDS-KTKKRGQNKSRPKIFKDGKES 459 S+ + KKTK E+ E+K + + K++ + KS + G S Sbjct: 1058 SWGTREVAVKKTKKELEEEKKQAEEAKRKAKQKSLLGFLQSGGTS 1102 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.7 Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +1 Query: 328 SFDDNNLEFKKTKIEITEDKNDS-KTKKRGQNKSRPKIFKDGKES 459 S+ + KKTK E+ E+K + + K++ + KS + G S Sbjct: 1058 SWGTREVAVKKTKKELEEEKKQAEEAKRKAKQKSLLGFLQSGGTS 1102 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.7 Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +1 Query: 328 SFDDNNLEFKKTKIEITEDKNDS-KTKKRGQNKSRPKIFKDGKES 459 S+ + KKTK E+ E+K + + K++ + KS + G S Sbjct: 1058 SWGTREVAVKKTKKELEEEKKQAEEAKRKAKQKSLLGFLQSGGTS 1102 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.4 bits (48), Expect = 1.7 Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = +1 Query: 328 SFDDNNLEFKKTKIEITEDKNDS-KTKKRGQNKSRPKIFKDGKES 459 S+ + KKTK E+ E+K + + K++ + KS + G S Sbjct: 1058 SWGTREVAVKKTKKELEEEKKQAEEAKRKAKQKSLLGFLQSGGTS 1102 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 22.2 bits (45), Expect = 3.9 Identities = 7/22 (31%), Positives = 15/22 (68%) Frame = -2 Query: 259 VTHIHLLLHKLLRWNSSYLCVM 194 VT +HL + +LR +++C++ Sbjct: 247 VTFVHLAVLNILRVGKNFVCLL 268 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.2 bits (45), Expect = 3.9 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 252 IFIFYCTNSCVGILHIYVLCS 190 I+ FYC + + +++LCS Sbjct: 56 IYYFYCVSITFNVHLLFLLCS 76 >AJ518940-1|CAD57734.1| 361|Tribolium castaneum extradenticle protein. Length = 361 Score = 21.0 bits (42), Expect = 8.9 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +1 Query: 229 VCAIKDEYVLQKSNIIEEKSYNLEKRKLD 315 +C IK++ VL N EE+ + + +LD Sbjct: 78 LCEIKEKTVLSLRNTQEEEPPDPQLMRLD 106 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,717 Number of Sequences: 336 Number of extensions: 2715 Number of successful extensions: 15 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -