BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_H20 (634 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1683.11c |||isocitrate lyase|Schizosaccharomyces pombe|chr 2... 28 1.3 SPBC1683.13c |||transcription factor |Schizosaccharomyces pombe|... 27 1.7 SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|c... 26 3.9 SPCC63.14 |||conserved fungal protein|Schizosaccharomyces pombe|... 26 3.9 SPCC417.10 |||membrane transporter|Schizosaccharomyces pombe|chr... 26 3.9 SPBC336.09c |rrn7||RNA polymerase I transcription factor subunit... 26 5.2 >SPBC1683.11c |||isocitrate lyase|Schizosaccharomyces pombe|chr 2|||Manual Length = 518 Score = 27.9 bits (59), Expect = 1.3 Identities = 22/101 (21%), Positives = 44/101 (43%), Gaps = 4/101 (3%) Frame = +3 Query: 87 ITKQNGP*AENAYRQRDRQ*KHHNEGECTQNYQGKRRPISCGTLAPCSLHLRSVWLCCVP 266 +TK P ++ A + D +H N+G T Y G P+ + L V C Sbjct: 46 VTKAYYPSSQQALKLYDLLREHRNKGTATLTY-GVVDPVLASQASKAGLETIFVSGCLCG 104 Query: 267 DNPINKTSLNHED-NWRT---AIENTIK*QHYPSKVRHNLH 377 + +++ ++H D W T A++ + Q++ ++ + H Sbjct: 105 LSSVDEPGMDHADYPWDTVPKAVDRIFRSQNWHARRQKQFH 145 >SPBC1683.13c |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 618 Score = 27.5 bits (58), Expect = 1.7 Identities = 15/53 (28%), Positives = 26/53 (49%) Frame = +3 Query: 126 RQRDRQ*KHHNEGECTQNYQGKRRPISCGTLAPCSLHLRSVWLCCVPDNPINK 284 + + RQ K + E + ++R I C L PC ++S C P++PI + Sbjct: 2 QMKPRQDKKNQEIFRISCQRCRQRKIKCDRLHPCFQCVKSNSQCFYPEDPIRR 54 >SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 865 Score = 26.2 bits (55), Expect = 3.9 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -3 Query: 218 QGATGYWSSFSLVVLGTFPLIVMFLLA 138 Q TG W+ +V+ F ++V+FLLA Sbjct: 146 QNVTGNWTWAHVVICYVFNVLVLFLLA 172 >SPCC63.14 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1184 Score = 26.2 bits (55), Expect = 3.9 Identities = 10/19 (52%), Positives = 14/19 (73%), Gaps = 1/19 (5%) Frame = -2 Query: 270 YLEH-SRATHYEDEESKEP 217 Y EH + +HYE+EE +EP Sbjct: 782 YFEHETEPSHYEEEEEEEP 800 >SPCC417.10 |||membrane transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 508 Score = 26.2 bits (55), Expect = 3.9 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +3 Query: 201 ISCGTLAPCSLHLRSVWLCCVPDNPINKTSLNHED 305 I CG LA + L V L VPDNP L ED Sbjct: 227 IICGVLA---IFLGFVILAVVPDNPFKAWFLTEED 258 >SPBC336.09c |rrn7||RNA polymerase I transcription factor subunit Rrn7 |Schizosaccharomyces pombe|chr 2|||Manual Length = 537 Score = 25.8 bits (54), Expect = 5.2 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -3 Query: 602 WNLWLELSLKIILKKRQKFIE 540 WN+WL KI K++ KF E Sbjct: 370 WNMWLSQVQKINEKEKDKFYE 390 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,516,817 Number of Sequences: 5004 Number of extensions: 51963 Number of successful extensions: 145 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 140 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 145 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 281707720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -