BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_H19 (652 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 22 3.8 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 22 5.0 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 22 5.0 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 6.7 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 21 8.8 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 22.2 bits (45), Expect = 3.8 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -2 Query: 225 LGLLERHTFGY 193 LG++ RH FGY Sbjct: 7 LGIMHRHCFGY 17 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 21.8 bits (44), Expect = 5.0 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = +3 Query: 309 QVMEEVSNIVNEIETNSGIEAAVIISGKPGCFIAGG*YKH 428 Q+ EEV+NI + + + ++ +P I G Y H Sbjct: 259 QISEEVANIWGLKKVYAPVVDGEFLTDEPIAIIKSGDYNH 298 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 21.8 bits (44), Expect = 5.0 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = +3 Query: 309 QVMEEVSNIVNEIETNSGIEAAVIISGKPGCFIAGG*YKH 428 Q+ EEV+NI + + + ++ +P I G Y H Sbjct: 261 QISEEVANIWGLKKVYAPVVDGEFLTDEPIAIIKSGDYNH 300 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 244 NLHFVCTWLAGTAYFRLCT 188 +L F C ++ T +F LCT Sbjct: 82 HLLFYCPFIIFTVHFLLCT 100 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 21.0 bits (42), Expect = 8.8 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = +3 Query: 309 QVMEEVSNIVNEIETNSGIEAAVIISGKPGCFIAGG*YKH 428 Q+ EEV+NI + + + ++ +P I G Y H Sbjct: 261 QISEEVANIWGLKKVYAPVVDGEFLTDEPIATIKSGDYNH 300 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 137,526 Number of Sequences: 336 Number of extensions: 2853 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -