BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_H17 (543 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45199| Best HMM Match : Ribosomal_S15 (HMM E-Value=1.5e-21) 127 7e-30 SB_25339| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_13861| Best HMM Match : Collagen (HMM E-Value=0.00048) 28 5.7 SB_6320| Best HMM Match : Exo_endo_phos (HMM E-Value=4.8) 27 7.5 SB_41319| Best HMM Match : NACHT (HMM E-Value=5.2e-14) 27 9.9 SB_38863| Best HMM Match : Fe_hyd_lg_C (HMM E-Value=2.3) 27 9.9 >SB_45199| Best HMM Match : Ribosomal_S15 (HMM E-Value=1.5e-21) Length = 135 Score = 127 bits (306), Expect = 7e-30 Identities = 58/67 (86%), Positives = 63/67 (94%) Frame = +1 Query: 292 IMKAMGLAPDLPEDLYYLIKKAVAMRKHLERNRKDKDSKFRLILVESRIHRLARYYKTKS 471 I+KA GLAP LPEDLY LIKKAVA+RKHLE+NRKDKDSKFRLIL+ESRIHRLARY+KTK Sbjct: 69 ILKAKGLAPSLPEDLYCLIKKAVAVRKHLEKNRKDKDSKFRLILIESRIHRLARYFKTKR 128 Query: 472 VLPPNWK 492 VLPPNWK Sbjct: 129 VLPPNWK 135 Score = 89.4 bits (212), Expect = 2e-18 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = +3 Query: 144 WLKLTADDVKEQIYKLGKKGLTPSQIGVMLRDSHGVAQVRFVTGKKILR 290 W KLT+DDVKEQ+YKL KKGLTPSQIGV+LRDS+GVAQVR++TG KILR Sbjct: 20 WQKLTSDDVKEQMYKLAKKGLTPSQIGVILRDSYGVAQVRYITGNKILR 68 >SB_25339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1049 Score = 27.9 bits (59), Expect = 5.7 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = -3 Query: 307 PLPS*XRRIFLPVTNLTWATPCESLSITP-ICEGVRPFFP 191 PLP FLPV N+ WAT ++LS P + VRP P Sbjct: 276 PLPQKLLVEFLPVDNVAWAT-VQNLSQNPRLRTSVRPKRP 314 >SB_13861| Best HMM Match : Collagen (HMM E-Value=0.00048) Length = 763 Score = 27.9 bits (59), Expect = 5.7 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +3 Query: 186 KLGKKGLTPSQIGVMLRD 239 KL K+GL+PSQI V+ RD Sbjct: 465 KLNKEGLSPSQIYVLARD 482 >SB_6320| Best HMM Match : Exo_endo_phos (HMM E-Value=4.8) Length = 845 Score = 27.5 bits (58), Expect = 7.5 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +2 Query: 32 CRCQIGDLVKSRKHGSYARSW*GYLP 109 CR +IG + KS KHGSY+ S G+ P Sbjct: 77 CRSRIG-IQKSTKHGSYSLSIPGHDP 101 >SB_41319| Best HMM Match : NACHT (HMM E-Value=5.2e-14) Length = 961 Score = 27.1 bits (57), Expect = 9.9 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +1 Query: 316 PDLPEDLYYL-IKKAVAMRKHLE-RNRKDKDSKFRLILVESRIHRLARYY 459 PD+P+D YYL + +++M L KD K +L++ L Y+ Sbjct: 146 PDIPDDNYYLSLSTSISMASVLSGSEEKDNFLKLCRLLIDGGTKSLLTYF 195 >SB_38863| Best HMM Match : Fe_hyd_lg_C (HMM E-Value=2.3) Length = 284 Score = 27.1 bits (57), Expect = 9.9 Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 3/60 (5%) Frame = +1 Query: 298 KAMGLAPDLPEDLYYLIKKAVAMRKHL---ERNRKDKDSKFRLILVESRIHRLARYYKTK 468 +A G+APD P +L LIK+ + + + + R+ K+ + + R+ + R +TK Sbjct: 124 RASGIAPDEPSELDQLIKQIIELEETTVPEDSQRQAKEKANKAKAEDVRLTAMERLSQTK 183 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,651,106 Number of Sequences: 59808 Number of extensions: 313785 Number of successful extensions: 734 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 674 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 733 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1239956166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -