BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_H17 (543 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 2.7 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 2.7 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 2.7 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 21 8.1 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 188 FVNLFLYIVGSQFQPGR 138 FVN FL+++ +Q GR Sbjct: 16 FVNSFLFVIAAQDSSGR 32 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 188 FVNLFLYIVGSQFQPGR 138 FVN FL+++ +Q GR Sbjct: 16 FVNSFLFVIAAQDSSGR 32 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -2 Query: 188 FVNLFLYIVGSQFQPGR 138 FVN FL+++ +Q GR Sbjct: 16 FVNSFLFVIAAQDSSGR 32 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.0 bits (42), Expect = 8.1 Identities = 14/55 (25%), Positives = 21/55 (38%) Frame = +2 Query: 125 PPQCPYLVEIDCRRCKGTNLQTWKEGSHSLTNWCNAEGFTWSCPSKIRNWQKDPP 289 PPQCP ++D G T K + ++ +A S P +D P Sbjct: 565 PPQCPRFRKLDSPSDSGIESGTEKPDKPASSSASSAPTSVCSSPRSEDKEVEDMP 619 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,204 Number of Sequences: 438 Number of extensions: 2764 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15459066 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -