BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fprWP01_F_H15 (506 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC17G9.07 |rps2402|rps24-2|40S ribosomal protein S24|Schizosac... 155 3e-39 SPAC17G6.06 |rps2401|rps24-1, rps24|40S ribosomal protein S24|Sc... 150 1e-37 SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual 28 0.70 SPCC417.06c |ppk35|mug27|serine/threonine protein kinase Ppk35|S... 28 0.92 SPAC328.09 |||2-oxoadipate and 2-oxoglutarate transporter |Schiz... 27 1.2 SPAC22A12.11 |dak1||dihydroxyacetone kinase Dak1|Schizosaccharom... 27 1.2 SPCC188.11 |prp45|cwf13, snw1, SPCC584.08|transcriptional regula... 26 2.8 SPAC1952.02 |||ribosome biogenesis protein|Schizosaccharomyces p... 25 8.6 SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr ... 25 8.6 SPBC56F2.01 |pof12||F-box protein Pof12|Schizosaccharomyces pomb... 25 8.6 SPAC12B10.01c ||SPAC31F12.02c, SPAC637.15c|ubiquitin-protein lig... 25 8.6 SPAC4A8.12c |sds22||protein phosphatase regulatory subunit Sds22... 25 8.6 SPBC4.07c |rpt2|mts2|19S proteasome regulatory subunit Rpt2|Schi... 25 8.6 >SPBC17G9.07 |rps2402|rps24-2|40S ribosomal protein S24|Schizosaccharomyces pombe|chr 2|||Manual Length = 134 Score = 155 bits (377), Expect = 3e-39 Identities = 79/122 (64%), Positives = 93/122 (76%), Gaps = 1/122 (0%) Frame = +1 Query: 67 MSEGTATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFG 246 MSE TIRTRKFMTNRLL RKQMV D+LHPGK +SK EIREKLA+MYK + V FG Sbjct: 1 MSEAV-TIRTRKFMTNRLLQRKQMVVDILHPGKANLSKNEIREKLAQMYKTDSECVQAFG 59 Query: 247 FKTNFGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEK-KRPTRKQRKERKNRMKKVR 423 +T+FGGG+STGFALIYD+ + KKFEP +RL R G E ++ R+QRK+RKNR KKV Sbjct: 60 LRTHFGGGRSTGFALIYDSTESMKKFEPHYRLVRVGQAEPIQKVARQQRKQRKNRGKKVF 119 Query: 424 GT 429 GT Sbjct: 120 GT 121 >SPAC17G6.06 |rps2401|rps24-1, rps24|40S ribosomal protein S24|Schizosaccharomyces pombe|chr 1|||Manual Length = 134 Score = 150 bits (363), Expect = 1e-37 Identities = 74/122 (60%), Positives = 91/122 (74%), Gaps = 1/122 (0%) Frame = +1 Query: 67 MSEGTATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVTPDVVFVFG 246 MSE TIRTRKFMTNRLL RKQMV D+LHPGK +SK ++REKL +MYK V FG Sbjct: 1 MSEAV-TIRTRKFMTNRLLQRKQMVVDILHPGKANISKNDLREKLGQMYKTDASAVQAFG 59 Query: 247 FKTNFGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEK-KRPTRKQRKERKNRMKKVR 423 +T++GGG++TGFALIYD ++ KKFEP +RL R G E ++ R+QRK+RKNR KKV Sbjct: 60 LRTHYGGGRTTGFALIYDDVEAMKKFEPHYRLVRVGHAEPIQKVARQQRKQRKNRGKKVF 119 Query: 424 GT 429 GT Sbjct: 120 GT 121 >SPCC5E4.04 |cut1||separase|Schizosaccharomyces pombe|chr 3|||Manual Length = 1828 Score = 28.3 bits (60), Expect = 0.70 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -3 Query: 102 FASANSRCSFTHFELFSII 46 F+S SRCSFT FE+ SI+ Sbjct: 776 FSSVISRCSFTDFEINSIL 794 >SPCC417.06c |ppk35|mug27|serine/threonine protein kinase Ppk35|Schizosaccharomyces pombe|chr 3|||Manual Length = 624 Score = 27.9 bits (59), Expect = 0.92 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 319 KFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 417 K+ P R G + +KR RK++ E+KN K Sbjct: 539 KYRPNARKPLVGRHREKRQLRKEKPEKKNNSTK 571 >SPAC328.09 |||2-oxoadipate and 2-oxoglutarate transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 298 Score = 27.5 bits (58), Expect = 1.2 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 2/47 (4%) Frame = +2 Query: 62 SK*VKEQRLFALANS*PTDCWRASRWFAMFY--IQENQLSARPRSVR 196 +K VK++R+ AL N WR W A ++ IQ+ + S P S R Sbjct: 149 TKIVKQERILALYNGFEATMWRHVVWNAGYFGVIQKIRNSLTPASSR 195 >SPAC22A12.11 |dak1||dihydroxyacetone kinase Dak1|Schizosaccharomyces pombe|chr 1|||Manual Length = 580 Score = 27.5 bits (58), Expect = 1.2 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 184 EIREKLAKMYKVTPDVVFVFGFKTNFGG 267 +++E LAK YK+ P +F F T+ G Sbjct: 286 KVKEALAKEYKINPVRIFAGPFTTSLNG 313 >SPCC188.11 |prp45|cwf13, snw1, SPCC584.08|transcriptional regulator Prp45|Schizosaccharomyces pombe|chr 3|||Manual Length = 557 Score = 26.2 bits (55), Expect = 2.8 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +3 Query: 231 SVRIRFQDKLRRWQINWIRFDLRHTRSGQEVRAQ-AQVSPPRPVREEEA 374 S R + +LRR + DLR +R G E RA+ A+ PR V E A Sbjct: 385 SEAFRRRQELRRERRRQAEKDLRLSRMGAEKRAKLAEKDRPRDVAERVA 433 >SPAC1952.02 |||ribosome biogenesis protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 202 Score = 24.6 bits (51), Expect = 8.6 Identities = 9/35 (25%), Positives = 21/35 (60%) Frame = +1 Query: 313 AKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKK 417 +KK + + + +K +K++KE+K+++KK Sbjct: 125 SKKVKVRKTSGKESSKREKSKKKKEKKEKKDKLKK 159 >SPAC6F6.01 |||VIC sodium channel |Schizosaccharomyces pombe|chr 1|||Manual Length = 1854 Score = 24.6 bits (51), Expect = 8.6 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 266 PPKFVLKPNTNTTSGVTLYILASFS 192 PPK LKP+ +T+ ++ Y LA S Sbjct: 818 PPKEPLKPSLDTSPELSKYSLAKLS 842 >SPBC56F2.01 |pof12||F-box protein Pof12|Schizosaccharomyces pombe|chr 2|||Manual Length = 440 Score = 24.6 bits (51), Expect = 8.6 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 5/39 (12%) Frame = +1 Query: 319 KFEPKHRLARHGLYEKKRPT-----RKQRKERKNRMKKV 420 +F KH L RHG EKKR R+Q + R KKV Sbjct: 58 EFGTKH-LRRHGRIEKKRRNWKGLFRRQSNWKDGRCKKV 95 >SPAC12B10.01c ||SPAC31F12.02c, SPAC637.15c|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1647 Score = 24.6 bits (51), Expect = 8.6 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 Query: 273 FATSEVCLETEYEHYIGSNL 214 +A SE LE EYE +GS L Sbjct: 1296 YAASENILEIEYEDEVGSGL 1315 >SPAC4A8.12c |sds22||protein phosphatase regulatory subunit Sds22 |Schizosaccharomyces pombe|chr 1|||Manual Length = 332 Score = 24.6 bits (51), Expect = 8.6 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -1 Query: 194 SRISVLLTVGFPGCKTSQTICLRANNL 114 SRI + ++G K Q++CLR N + Sbjct: 48 SRIQSMASLGLERFKNLQSLCLRQNQI 74 >SPBC4.07c |rpt2|mts2|19S proteasome regulatory subunit Rpt2|Schizosaccharomyces pombe|chr 2|||Manual Length = 448 Score = 24.6 bits (51), Expect = 8.6 Identities = 8/23 (34%), Positives = 17/23 (73%) Frame = +1 Query: 361 EKKRPTRKQRKERKNRMKKVRGT 429 E+ +P ++ +E +NR+ ++RGT Sbjct: 90 ERLKPQDERTQEERNRVDEIRGT 112 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,160,653 Number of Sequences: 5004 Number of extensions: 45037 Number of successful extensions: 138 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 202220600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -